CX295738

Overview
NameCX295738
Unique NameCX295738
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length604
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX295738 vs. ExPASy Swiss-Prot
Match: 4CLL7_ARATH (4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 2.313e-61
Identity = 118/198 (59.60%), Postives = 150/198 (75.76%), Query Frame = 1
Query:    4 GYGRDGIYRSLRPPFVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQFKSIVIKVSHSFRHLGITKKDVVLIFAPNSIQFPICFLGVIAIGAIASTANTVYTVSELSKQVKDSNPKLVITVPELWDKVKGLNLPAVLLGSKDXXXXXXXXXXXXXXXXFHDLIELSGSVTDIPDVSVKQTDAAALLYSSG 597
            GYGRDGIYRSLRP  VLP DP+ S+V FLFRNS+SY SKLA+ D+D+ +SL+FSQ KS V +++H F  LGI K DVVLIFAPNS QFP+CFL V AIG + +TAN +YTV+E+SKQ+KDSNPK++I+V +L+DK+KG +LP VLLGSKD                F +++ELS  V++ P V +KQ+D AALLYSSG
Sbjct:    5 GYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLAIADSDTGDSLTFSQLKSAVARLAHGFHRLGIRKNDVVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVSKQIKDSNPKIIISVNQLFDKIKGFDLPVVLLGSKD--TVEIPPGSNSKILSFDNVMELSEPVSEYPFVEIKQSDTAALLYSSG 200          
BLAST of CX295738 vs. ExPASy Swiss-Prot
Match: 4CLL1_ORYSJ (4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 1.617e-30
Identity = 76/200 (38.00%), Postives = 109/200 (54.50%), Query Frame = 1
Query:    4 GYGRDGIYRSLRPPFVLPSDPSFSMVHFLFRNSASYSSKLALIDADSD-ESLSFSQFKSIVIKVSHSFR-HLGITKKDVVLIFAPNSIQFPICFLGVIAIGAIASTANTVYTVSELSKQVKDSNPKLVITVPELWDKVKGLNLPAVLLGSKDXXXXXXXXXXXXXXXXFHDLIELSGSVTDIPDVSVKQTDAAALLYSSG 597
            GYG DG+YRSLRPP  + SDP  S+   L R + +  S +AL DA +   +L+F++ +S V+  + +     G+   D VL+ APN + +P+CF  V A+GA+ +T N  YT  E++KQV D+  KLVIT+  L  K+ GL LP +LL   D                 +  +       D     +KQ+D AALLYSSG
Sbjct:   10 GYGADGVYRSLRPPAPVASDPGLSLTDLLLRRADACPSAVALADAAAGGRALTFAELRSAVLSTAVALSSRAGVRPGDAVLLLAPNCVLYPVCFFAVTALGAVGTTVNPDYTPREIAKQVSDARAKLVITISALVPKIAGLRLPVILL--DDDANAAAASLPPDATVTLYTNLVAGVKEADYRRPPIKQSDTAALLYSSG 207          
BLAST of CX295738 vs. ExPASy Swiss-Prot
Match: 4CLL2_ORYSJ (4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=2 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 2.764e-22
Identity = 69/194 (35.57%), Postives = 101/194 (52.06%), Query Frame = 1
Query:   19 GIYRSLRPPFVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQFKSIVIKVSHSFRH-LGITKKDVVLIFAPNSIQFPICFLGVIAIGAIASTANTVYTVSELSKQVKDSNPKLVITVPELWDKVKGLNLPAVLLGSKDXXXXXXXXXXXXXXXXFHDLIELSGSVTDIPDVSVKQTDAAALLYSSG 597
            G+Y SL PP  LPSDPS S+V  LF +   +   L L+DA +  +LS + F+ +V  ++   R  L I +  +VL+  PNS+ FP+ FL V+A GA+A+T N     +E++ +++D+ P LV+       K+  L  P VL+                    FH L+E          V V Q DAAA+LYSSG
Sbjct:   21 GLYSSLHPPLPLPSDPSLSLVPHLFSHLPLHHHSL-LVDAPTAATLSCADFRRLVSSLAAGLRRRLHIARGSLVLLLLPNSLTFPVAFLAVLATGAVATTMNPSSAPAEIAARLRDTAPSLVLASTHNAAKLPPLAAPLVLV----PDTFQQQHDDDQFDFFFHALLETDPETPVEMGVGVGQDDAAAVLYSSG 209          
BLAST of CX295738 vs. ExPASy Swiss-Prot
Match: 4CLL8_ARATH (4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 8.043e-22
Identity = 69/201 (34.33%), Postives = 103/201 (51.24%), Query Frame = 1
Query:   25 YRSLRPPFVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQFKSIVIKVSHSFRH-LGITKKDVVLIFAPNSIQFPICFLGVIAIGAIASTANTVYTVSELSKQVKDSNPKLVITVPELWDKVKGLNLPAVLLGSKDXXXXXXXXXXXXXXXXFHDLIELSGSVTDIPDV---------SVKQTDAAALLYSSG 597
            + S R P  LPS  S  +  F+  +S +Y  K A IDA +D  +SFS     V +V+    H +GI + DVVL+ +PN+I  PI  L V+++GA+ +TAN + T SE+ +Q+ DSNPKL  T PEL  K+    +  VL   +D                    +++ G++T++             V + D A LLYSSG
Sbjct:   24 FYSKRKPLALPSKESLDITTFI--SSQTYRGKTAFIDAATDHRISFSDLWMAVDRVADCLLHDVGIRRGDVVLVLSPNTISIPIVCLSVMSLGAVLTTANPLNTASEILRQIADSNPKLAFTTPELAPKIASSGISIVLERVEDTLRVPRG-------------LKVVGNLTEMMKKEPSGQAVRNQVHKDDTAMLLYSSG 209          
BLAST of CX295738 vs. ExPASy Swiss-Prot
Match: 4CLL5_ARATH (4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 6.809e-21
Identity = 64/193 (33.16%), Postives = 103/193 (53.37%), Query Frame = 1
Query:   25 YRSLRPPFVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQFKSIVIKVSHSFRHLGITKKDVVLIFAPNSIQFPICFLGVIAIGAIASTANTVYTVSELSKQVKDSNPKLVITVPELWDKVKGL--NLPAVLLGSKDXXXXXXXXXXXXXXXXFHDLIELSGSVTDIPDVSVKQTDAAALLYSSG 597
            + S R P  LP +PS  +  F+  +S ++  ++A IDA + ++L+F++    V  V+     +GI K  VVL+ +PNSI FP+  L V+++GAI +T N + T +E++KQ+KDSNP L  T  +L  K+      LP VL+  +                   ++++   S   + +  V Q D A LLYSSG
Sbjct:   17 FYSKRTPIPLPPNPSLDVTTFI--SSQAHRGRIAFIDASTGQNLTFTELWRAVESVADCLSEIGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSNEIAKQIKDSNPVLAFTTSQLLPKISAAAKKLPIVLMDEERVDSVGDVRRLV-------EMMKKEPSGNRVKE-RVDQDDTATLLYSSG 199          
BLAST of CX295738 vs. ExPASy Swiss-Prot
Match: 4CLL3_ARATH (4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 9.832e-20
Identity = 65/192 (33.85%), Postives = 99/192 (51.56%), Query Frame = 1
Query:   25 YRSLRPPFVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQFKSIVIKVSHSFRH-LGITKKDVVLIFAPNSIQFPICFLGVIAIGAIASTANTVYTVSELSKQVKDSNPKLVITVPELWDKVKGLNLPAVLLGSKDXXXXXXXXXXXXXXXXFHDLIELSGSVTDIPDVSVKQTDAAALLYSSG 597
            + S R P  LP +PS  +  F+  +S       A IDA +   L+FS    +V +V+    H +GI + DVVLI +PNSI  P+  L V+++GA+ +TANT+ T  E+SKQ+  SNP LV T  +L  K+      +V+L  ++                  ++++   S   + D  V Q D A +LYSSG
Sbjct:   23 FYSKRNPLCLPPNPSLDVTTFI--SSQPQRGTTAFIDASTGHRLTFSDLWRVVDRVADCLYHEVGIRRGDVVLILSPNSIYIPVVCLSVMSLGAVVTTANTLNTSGEISKQIAQSNPTLVFTTSQLAPKLAA--AISVVLTDEEDEKRVELTSGVRVVGILSEMMKKETSGQRVRD-RVNQDDTAMMLYSSG 209          
BLAST of CX295738 vs. ExPASy Swiss-Prot
Match: 4CLL2_ARATH (4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 8.323e-19
Identity = 68/195 (34.87%), Postives = 95/195 (48.72%), Query Frame = 1
Query:   22 IYRSLRPPFVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQFKSIVIKVSHSFRHLGITKKDVVLIFAPNSIQFPICFLGVIAIGAIASTANTVYTVSELSKQVKDSNPKLVITVPELWDKV---KGLNLPAVLLGSKDXXXXXXXXXXXXXXXXFHDLIELSGSVTDIPDVSVKQTDAAALLYSSG 597
            I+ S R P  LP +    +  F+   S  +  K   +DA +   LSF +    V +V+     LG+ K +VV+I +PNSI FPI  L V+++GAI +TAN + T  E+SKQ+ DS P L  T  +L  K+      NLP VL+                       +IE   S + +    V Q D AALLYSSG
Sbjct:   33 IFYSKREPMALPPNQFLDVTSFIA--SQPHRGKTVFVDAVTGRRLSFPELWLGVERVAGCLYALGVRKGNVVIILSPNSILFPIVSLSVMSLGAIITTANPINTSDEISKQIGDSRPVLAFTTCKLVSKLAAASNFNLPVVLMDDY-HVPSQSYGDRVKLVGRLETMIETEPSESRVKQ-RVNQDDTAALLYSSG 223          
BLAST of CX295738 vs. ExPASy Swiss-Prot
Match: 4CLL4_ARATH (4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.420e-18
Identity = 66/192 (34.38%), Postives = 99/192 (51.56%), Query Frame = 1
Query:   25 YRSLRPPFVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQFKSIVIKVSHSFRH-LGITKKDVVLIFAPNSIQFPICFLGVIAIGAIASTANTVYTVSELSKQVKDSNPKLVITVPELWDKVKGLNLPAVLLGSKDXXXXXXXXXXXXXXXXFHDLIELSGSVTDIPDVSVKQTDAAALLYSSG 597
            + S R P  LP + S  +  F+  +S  +  K A IDA + + L+FS     V +V+    H +GI + DVVLI +PNSI  P+  L V+++GA+ +TANT+ T  E+SKQ+ DSNP LV T  +L  K+      A+ +   D                  ++++   S   + D  V Q D A +LYSSG
Sbjct:   23 FYSKRQPLSLPPNLSRDVTTFI--SSQPHRGKTAFIDAATGQCLTFSDLWRAVDRVADCLYHEVGIRRGDVVLILSPNSIFIPVVCLSVMSLGAVFTTANTLNTSGEISKQIADSNPTLVFTTRQLAPKLP----VAISVVLTDDEVYQELTSAIRVVGILSEMVKKEPSGQRVRD-RVNQDDTAMMLYSSG 207          
BLAST of CX295738 vs. ExPASy Swiss-Prot
Match: 4CLL6_ARATH (4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 4.567e-17
Identity = 60/196 (30.61%), Postives = 99/196 (50.51%), Query Frame = 1
Query:   13 RDGIYRSLRPPFVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQFKSIVIKVSHSFRH-LGITKKDVVLIFAPNSIQFPICFLGVIAIGAIASTANTVYTVSELSKQVKDSNPKLVITVPELWDKVKGLNLPAVLLGSKDXXXXXXXXXXXXXXXXFHDLIELSGSVTDIPDVSVKQTDAAALLYSSG 597
            + GIY S  P   LP DP+   V  LF  S  +    ALID+ +  S+S ++ + +V  ++    H LG+ + DVV +  PNS+ FP+ FL +I++GAI +T N   ++ E+ KQV + +  L  T  E  +K+  L +  + +                    F+ +++ S     +P   +KQ D AA++YSSG
Sbjct:   28 KTGIYTSKFPSLHLPVDPNLDAVSALF--SHKHHGDTALIDSLTGFSISHTELQIMVQSMAAGIYHVLGVRQGDVVSLVLPNSVYFPMIFLSLISLGAIVTTMNPSSSLGEIKKQVSECSVGLAFTSTENVEKLSSLGVSVISVSES-----YDFDSIRIENPKFYSIMKESFGF--VPKPLIKQDDVAAIMYSSG 214          
BLAST of CX295738 vs. ExPASy Swiss-Prot
Match: 4CL1_ARATH (4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.017e-16
Identity = 59/196 (30.10%), Postives = 100/196 (51.02%), Query Frame = 1
Query:   16 DGIYRSLRPPFVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQFKSIVIKVSHSFRHLGITKKDVVLIFAPNSIQFPICFLGVIAIGAIASTANTVYTVSELSKQVKDSNPKLVITVPELWDKVKGL-NLPAVLLGSKDXXXXXXXXXXXXXXXXFHDLIELSGSVTDIPD-VSVKQTDAAALLYSSG 597
            D I+RS  P   +P+    S+  ++F+N + +++K  LI+  +    ++S    I  +++ +F  LG+ + DVV++  PN  +F + FL     GA A+ AN  +T +E++KQ K SN KL+IT     DK+K L N   V++   D                F +L + +   +++ D V +   D  AL YSSG
Sbjct:   22 DVIFRSKLPDIYIPNH--LSLHDYIFQNISEFATKPCLINGPTGHVYTYSDVHVISRQIAANFHKLGVNQNDVVMLLLPNCPEFVLSFLAASFRGATATAANPFFTPAEIAKQAKASNTKLIITEARYVDKIKPLQNDDGVVIVCID---DNESVPIPEGCLRFTELTQSTTEASEVIDSVEISPDDVVALPYSSG 212          
The following BLAST results are available for this feature:
BLAST of CX295738 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
4CLL7_ARATH2.313e-6159.604-coumarate--CoA ligase-like 7 OS=Arabidopsis thal... [more]
4CLL1_ORYSJ1.617e-3038.004-coumarate--CoA ligase-like 1 OS=Oryza sativa sub... [more]
4CLL2_ORYSJ2.764e-2235.574-coumarate--CoA ligase-like 2 OS=Oryza sativa sub... [more]
4CLL8_ARATH8.043e-2234.334-coumarate--CoA ligase-like 8 OS=Arabidopsis thal... [more]
4CLL5_ARATH6.809e-2133.164-coumarate--CoA ligase-like 5 OS=Arabidopsis thal... [more]
4CLL3_ARATH9.832e-2033.854-coumarate--CoA ligase-like 3 OS=Arabidopsis thal... [more]
4CLL2_ARATH8.323e-1934.874-coumarate--CoA ligase-like 2 OS=Arabidopsis thal... [more]
4CLL4_ARATH1.420e-1834.384-coumarate--CoA ligase-like 4 OS=Arabidopsis thal... [more]
4CLL6_ARATH4.567e-1730.614-coumarate--CoA ligase-like 6 OS=Arabidopsis thal... [more]
4CL1_ARATH1.017e-1630.104-coumarate--CoA ligase 1 OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05075D04SK DroRLeaf1 Citrus clementina cDNA clone C05075D04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295738 ID=CX295738|Name=CX295738|organism=Citrus clementina|type=EST|length=604bp
GAGGGTTATGGCCGTGATGGTATCTACAGATCTTTAAGGCCACCTTTTGT
TCTTCCCAGTGACCCCAGTTTTTCTATGGTTCATTTTCTCTTTAGAAACT
CTGCTTCTTATAGCTCCAAATTAGCACTTATTGATGCTGATTCGGATGAA
TCTTTGTCTTTTTCCCAGTTCAAATCCATTGTGATCAAGGTTTCTCATAG
CTTTCGCCATCTGGGCATTACAAAAAAAGATGTTGTTTTGATTTTTGCTC
CAAATTCAATTCAGTTCCCTATTTGCTTTCTTGGTGTCATTGCTATAGGC
GCTATAGCATCAACTGCCAATACTGTTTACACGGTCTCTGAGCTTTCAAA
GCAAGTCAAGGATTCCAATCCAAAACTTGTTATTACAGTCCCTGAATTAT
GGGACAAAGTTAAAGGCTTAAACTTGCCAGCTGTCCTTTTAGGTTCAAAA
GATAAGGTTTCTTCTTCTGGTCTTATTTCAAGAAGCTCTAAGATTGTTTC
TTTTCATGACTTGATTGAATTATCTGGGAGTGTAACAGATATTCCAGATG
TTTCTGTTAAGCAAACAGATGCTGCTGCTCTGTTGTACTCTTCAGGACAC
TGGT
back to top