CX295744

Overview
NameCX295744
Unique NameCX295744
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length738
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10259 contig Ccv1_Contig10259:21..758. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX295744 vs. ExPASy Swiss-Prot
Match: RL5_CUCSA (60S ribosomal protein L5 OS=Cucumis sativus GN=RPL5 PE=2 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 2.530e-109
Identity = 193/230 (83.91%), Postives = 210/230 (91.30%), Query Frame = 1
Query:   40 MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFXXXXXXXXXXXXIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGM 729
            MAF KAQK+KAYFKR+QVK+KRRREGKTDYRARIRLINQDKNKYNTPKYRFVVR +NKDI AQI+SA+I GD VLA+AY+HELP+YGLEVGLTNYAAAYCTGLLLARRVLKMLEMD EYEGNVEATGEDYSVEPADTRRPFRALLDVGLI+TTTGNRVF            IPHSDKRFAG++K+G+QLD EVHRKYI+GGHVAAYM TLMEDEPEKYQSHF+EYIKKG+
Sbjct:    1 MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDITAQIISASIAGDLVLASAYSHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYAKNGQQLDVEVHRKYIFGGHVAAYMRTLMEDEPEKYQSHFSEYIKKGI 230          
BLAST of CX295744 vs. ExPASy Swiss-Prot
Match: RL52_ARATH (60S ribosomal protein L5-2 OS=Arabidopsis thaliana GN=RPL5B PE=2 SV=3)

HSP 1 Score: 375.941 bits (964), Expect = 1.216e-103
Identity = 183/230 (79.57%), Postives = 201/230 (87.39%), Query Frame = 1
Query:   40 MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFXXXXXXXXXXXXIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGM 729
            M FVK+ KS AYFKR+QVK++RRR+GKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI+AQIVSA+I GD V A+AYAHELP+YGL VGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGED+SVEP D+RRPFRALLDVGLI+TTTGNRVF            IPHSDKRFAGF K+ KQLDAE+HR YIYGGHV+ YM  L EDEPEK Q+HF+ YIKKG+
Sbjct:    1 MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGV 230          
BLAST of CX295744 vs. ExPASy Swiss-Prot
Match: RL51_ARATH (60S ribosomal protein L5-1 OS=Arabidopsis thaliana GN=ATL5 PE=2 SV=2)

HSP 1 Score: 375.555 bits (963), Expect = 1.588e-103
Identity = 183/230 (79.57%), Postives = 201/230 (87.39%), Query Frame = 1
Query:   40 MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFXXXXXXXXXXXXIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGM 729
            M FVK+ KS AYFKR+QVK++RRR+GKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI+AQIVSA+I GD V A+AYAHELP+YGL VGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGED+SVEP D+RRPFRALLDVGLI+TTTGNRVF            IPHSDKRFAGF K+ KQLDAE+HR YIYGGHV+ YM  L EDEPEK Q+HF+ YIKKG+
Sbjct:    1 MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGV 230          
BLAST of CX295744 vs. ExPASy Swiss-Prot
Match: RL51_ORYSI (60S ribosomal protein L5-1 OS=Oryza sativa subsp. indica GN=RPL5A PE=2 SV=2)

HSP 1 Score: 368.622 bits (945), Expect = 1.942e-101
Identity = 177/228 (77.63%), Postives = 198/228 (86.84%), Query Frame = 1
Query:   46 FVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFXXXXXXXXXXXXIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGM 729
            FVK QK+ AY+KRFQVK+KRRR+GKTDYRARIRL NQDKNKYNTPKYRFVVRFTNKDI AQIV A I GD V+AAAY+HELPRYGLEVGLTNYAAAYCTGLLLARRVLK+  +D EYEGN+EATGEDY VEPAD RRPFRALLDVGLI+TTTGNRVF            IPHSDKRFAGF KD KQLD+++HRKYIYGGHVA YM ++ E+EPEK+Q+HF+EY+KKG+
Sbjct:    4 FVKTQKTNAYYKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGNIEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGI 231          
BLAST of CX295744 vs. ExPASy Swiss-Prot
Match: RL51_ORYSJ (60S ribosomal protein L5-1 OS=Oryza sativa subsp. japonica GN=RPL5A PE=2 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 5.649e-101
Identity = 177/228 (77.63%), Postives = 197/228 (86.40%), Query Frame = 1
Query:   46 FVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFXXXXXXXXXXXXIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGM 729
            FVK QK+ AY KRFQVK+KRRR+GKTDYRARIRL NQDKNKYNTPKYRFVVRFTNKDI AQIV A I GD V+AAAY+HELPRYGLEVGLTNYAAAYCTGLLLARRVLK+  +D EYEGN+EATGEDY VEPAD RRPFRALLDVGLI+TTTGNRVF            IPHSDKRFAGF KD KQLD+++HRKYIYGGHVA YM ++ E+EPEK+Q+HF+EY+KKG+
Sbjct:    4 FVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGNIEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGI 231          
BLAST of CX295744 vs. ExPASy Swiss-Prot
Match: RL52_ORYSJ (60S ribosomal protein L5-2 OS=Oryza sativa subsp. japonica GN=RPL5B PE=3 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 9.972e-98
Identity = 175/228 (76.75%), Postives = 194/228 (85.09%), Query Frame = 1
Query:   46 FVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFXXXXXXXXXXXXIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGM 729
            FVK QK+ AYFKRFQVK+KRRR+GKTDYRARIRL NQDKNKYNTPKYRFV   TNKDI AQIV A I GD V+AAAY+HELPRYGLEVGLTNYAAAYCTGLLLARRVL +  +D EYEGNVEATGEDY VEPAD RRPFRALLDVGLI+TTTGNRVF            IPHSDKRFAGF KD KQLD+++HRKYIYGGHVA YM ++ E+EPEK+Q+HF+EY+KKG+
Sbjct:    7 FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDITAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEGNVEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGI 231          
BLAST of CX295744 vs. ExPASy Swiss-Prot
Match: RL5_SUBDO (60S ribosomal protein L5 OS=Suberites domuncula GN=RPL5 PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.354e-78
Identity = 143/231 (61.90%), Postives = 176/231 (76.19%), Query Frame = 1
Query:   40 MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDYSVE-PADTRRPFRALLDVGLIKTTTGNRVFXXXXXXXXXXXXIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGM 729
            M FVK  K+KAYFKR+QVK++RRREGKTDYRAR RL+ QDKNKYNTPKYR V+RFTN DII QI+ A I GD VL +AYAHELPRYG++VGLTNYAAAYCTGLLLARR+L  L + D+Y G  +  GED++VE   D  RPFRA LDVGL +TTTGNRVF            IPHS  RF G+ ++  QL+A+  R+YI+GGHV+ YM  L E++ EKY++HF+ +IK+G+
Sbjct:    1 MPFVKVIKNKAYFKRYQVKFRRRREGKTDYRARKRLVVQDKNKYNTPKYRIVIRFTNTDIICQIIYAKIEGDKVLVSAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTNLGLADKYAGQTDIDGEDFNVEHMGDGPRPFRAFLDVGLTRTTTGNRVFAAMKGAVDGGIDIPHSPSRFVGYDEESSQLEADKLRQYIFGGHVSDYMKYLQEEDEEKYKAHFSRFIKEGI 231          
BLAST of CX295744 vs. ExPASy Swiss-Prot
Match: RL5_STYCL (60S ribosomal protein L5 OS=Styela clava GN=RPL5 PE=3 SV=3)

HSP 1 Score: 276.559 bits (706), Expect = 1.004e-73
Identity = 136/231 (58.87%), Postives = 167/231 (72.29%), Query Frame = 1
Query:   40 MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDYSVEPADTR-RPFRALLDVGLIKTTTGNRVFXXXXXXXXXXXXIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGM 729
            M FVK  K+KAYFKR+QVKYKRRR+GKTDY AR RL+ QDKNKYNTPKYR +VRFTNKDI+ QI  A I GD V+ AAYAHELPRYG++VGLTNYAAAYCTGLLL+RR+L    +D+ YEG  E  G+++ VE  D +   FRA LDVGL +TTTG +VF            IPHS KRF G+  +     AEVHR +I+GGHV+ YM  L E++ E ++  F++YIK G+
Sbjct:    1 MGFVKVVKNKAYFKRYQVKYKRRRQGKTDYFARKRLVVQDKNKYNTPKYRMIVRFTNKDIVCQIAYARIEGDVVICAAYAHELPRYGVKVGLTNYAAAYCTGLLLSRRLLNKFGLDEIYEGQTEIDGDEFYVEDVDGKPGAFRAFLDVGLARTTTGAKVFGAMKGAADGGLDIPHSTKRFPGYDDESGDFSAEVHRSHIFGGHVSNYMKELEEEDEEAFKRQFSQYIKHGV 231          
BLAST of CX295744 vs. ExPASy Swiss-Prot
Match: RL5_HUMAN (60S ribosomal protein L5 OS=Homo sapiens GN=RPL5 PE=1 SV=3)

HSP 1 Score: 275.789 bits (704), Expect = 1.713e-73
Identity = 136/231 (58.87%), Postives = 168/231 (72.73%), Query Frame = 1
Query:   40 MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDYSVEPADTR-RPFRALLDVGLIKTTTGNRVFXXXXXXXXXXXXIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGM 729
            M FVK  K+KAYFKR+QVK++RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DII QI  A I GD ++ AAYAHELP+YG++VGLTNYAAAYCTGLLLARR+L    MD  YEG VE TG++Y+VE  D +   F   LD GL +TTTGN+VF            IPHS KRF G+  + K+ +AEVHRK+I G +VA YM  LME++ + Y+  F++YIK  +
Sbjct:    1 MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNSV 231          
BLAST of CX295744 vs. ExPASy Swiss-Prot
Match: RL5_DUNSA (60S ribosomal protein L5 OS=Dunaliella salina GN=RPL5 PE=2 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.713e-73
Identity = 133/228 (58.33%), Postives = 170/228 (74.56%), Query Frame = 1
Query:   40 MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDYSVEPA-DTRRPFRALLDVGLIKTTTGNRVFXXXXXXXXXXXXIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIK 720
            M +VK  K+  YF R+QVKY+RRR+GKTDYRAR+RL+ QDKNKYNT KYR VVRF+NK++  QIV + I GD V+AAAY+ ELP YGL+VGLTNY+AAYC GLL+ARR+L  L + D Y+G  E  GEDY+VEP  D  +PF  LLD GL +T+TG++VF            IPH++KRF G++   K+LD EV +KYIYGGHVA Y  T+ E+EPEKYQ+HF+ Y++
Sbjct:    1 MGYVKVVKTSPYFSRYQVKYRRRRQGKTDYRARLRLVRQDKNKYNTHKYRLVVRFSNKNVTCQIVYSTIQGDVVMAAAYSKELPNYGLKVGLTNYSAAYCVGLLVARRILTKLNLADTYKGQEEPDGEDYNVEPVEDGPKPFYCLLDTGLKRTSTGSKVFAAMKGALDGGLDIPHNEKRFVGYA--DKKLDTEVLQKYIYGGHVAEYQETMQEEEPEKYQAHFSSYVE 226          
The following BLAST results are available for this feature:
BLAST of CX295744 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 92
Match NameE-valueIdentityDescription
RL5_CUCSA2.530e-10983.9160S ribosomal protein L5 OS=Cucumis sativus GN=RPL... [more]
RL52_ARATH1.216e-10379.5760S ribosomal protein L5-2 OS=Arabidopsis thaliana... [more]
RL51_ARATH1.588e-10379.5760S ribosomal protein L5-1 OS=Arabidopsis thaliana... [more]
RL51_ORYSI1.942e-10177.6360S ribosomal protein L5-1 OS=Oryza sativa subsp. ... [more]
RL51_ORYSJ5.649e-10177.6360S ribosomal protein L5-1 OS=Oryza sativa subsp. ... [more]
RL52_ORYSJ9.972e-9876.7560S ribosomal protein L5-2 OS=Oryza sativa subsp. ... [more]
RL5_SUBDO1.354e-7861.9060S ribosomal protein L5 OS=Suberites domuncula GN... [more]
RL5_STYCL1.004e-7358.8760S ribosomal protein L5 OS=Styela clava GN=RPL5 P... [more]
RL5_HUMAN1.713e-7358.8760S ribosomal protein L5 OS=Homo sapiens GN=RPL5 P... [more]
RL5_DUNSA1.713e-7358.3360S ribosomal protein L5 OS=Dunaliella salina GN=R... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05075D10SK DroRLeaf1 Citrus clementina cDNA clone C05075D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295744 ID=CX295744|Name=CX295744|organism=Citrus clementina|type=EST|length=738bp
CGAGGCTCTCCTTTTCTCTTAAATTCGAAAGTTCGAGCAATGGCCTTTGT
CAAGGCTCAGAAATCCAAGGCTTACTTCAAGCGGTTCCAGGTTAAGTACA
AGAGAAGAAGAGAGGGAAAGACTGATTACAGAGCTAGAATTCGCCTGATT
AATCAGGACAAGAATAAGTACAACACACCCAAGTACCGATTTGTTGTCCG
ATTCACAAACAAGGACATCATTGCACAGATAGTGTCAGCCAACATTGTTG
GTGATTCTGTCCTTGCTGCTGCTTATGCCCATGAGCTTCCTCGTTATGGA
CTTGAAGTAGGTCTTACAAACTATGCTGCAGCTTATTGCACTGGGCTTCT
TTTGGCTCGTCGTGTCTTGAAGATGCTTGAAATGGATGATGAGTATGAGG
GCAATGTTGAGGCTACTGGAGAGGATTACTCTGTCGAACCAGCTGATACA
AGGAGGCCATTCCGTGCTCTCCTTGATGTTGGGCTCATCAAAACAACAAC
TGGAAACCGTGTGTTTGGTGCTCTGAAGGGAGCATTAGATGGTGGATTGG
ACATTCCTCATAGTGACAAGAGGTTTGCTGGTTTTTCAAAGGACGGCAAG
CAGCTGGATGCTGAGGTTCACCGCAAGTATATCTATGGTGGACATGTTGC
TGCTTACATGAGTACATTGATGGAAGATGAGCCAGAGAAGTATCAATCTC
ACTTCACTGAGTACATCAAGAAAGGAATGATGCTGATG
back to top