CX295747

Overview
NameCX295747
Unique NameCX295747
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length732
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX295747 vs. ExPASy Swiss-Prot
Match: LE14B_LITER (LEC14B protein OS=Lithospermum erythrorhizon PE=2 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.282e-53
Identity = 101/166 (60.84%), Postives = 130/166 (78.31%), Query Frame = 3
Query:  207 MGYAMSRFEIESEFYDAADTVNQASNSRSKFKKPLSALDHEIAQLTKLKSEPKEHFSKEVPGKRHLPVSTVKMLAGREGNYSGRGRFSAADCCHMLSRYLPVNGPWPVDQTTSRAYVSQFSADGSLFVAGFQASQIRIYDVERGWKIQKDILAKSLRWTVTDTSLS 704
            MGYAMSRFE +     ++ + ++ S+  S   KP+  LDHEIAQLT+L+S P E+ S+++  KR LP+ST+KMLAGRE N SGRGRFS+ADCCH++SR+LPVN P  VDQ TSR Y+SQFS DGSLF+AGFQ   IRIY+V++GWK+Q DI+AK +RWT+TD SLS
Sbjct:    1 MGYAMSRFETDVSVIFSSSSDSETSHD-SLINKPVKNLDHEIAQLTRLRSAPHENLSRDLLVKRVLPLSTMKMLAGREANVSGRGRFSSADCCHVVSRHLPVNDPCVVDQMTSRVYLSQFSTDGSLFIAGFQGCHIRIYNVDKGWKVQNDIIAKCVRWTITDASLS 165          
BLAST of CX295747 vs. ExPASy Swiss-Prot
Match: LE14B_PRUAR (LEC14B homolog OS=Prunus armeniaca PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 4.436e-50
Identity = 97/161 (60.25%), Postives = 123/161 (76.40%), Query Frame = 3
Query:  222 SRFEIESEFYDAADTVNQASNSRSKFKKPLSALDHEIAQLTKLKSEPKEHFSKEVPGKRHLPVSTVKMLAGREGNYSGRGRFSAADCCHMLSRYLPVNGPWPVDQTTSRAYVSQFSADGSLFVAGFQASQIRIYDVERGWKIQKDILAKSLRWTVTDTSLS 704
            +RF  ++   D+ + V  + +S+    +  +  DHEIAQLTK +S P +  S+++PGK  L VST+KML GRE N+SGRGRFS+AD CH+LSRYLP+NGPW VDQ+TS AYVSQFS DG  FVAGFQ   IRIY+V++GWK+QKDIL KSLRWT+TDTSLS
Sbjct:    5 TRFGKDNSACDSGNAVEGSGSSKGP-NEVSNDFDHEIAQLTKHRSRPHQLLSQDMPGKSRLLVSTMKMLVGRESNHSGRGRFSSADGCHVLSRYLPINGPWGVDQSTSPAYVSQFSNDGLFFVAGFQGGHIRIYNVDKGWKVQKDILTKSLRWTITDTSLS 164          
The following BLAST results are available for this feature:
BLAST of CX295747 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
LE14B_LITER3.282e-5360.84LEC14B protein OS=Lithospermum erythrorhizon PE=2 ... [more]
LE14B_PRUAR4.436e-5060.25LEC14B homolog OS=Prunus armeniaca PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionC05075E02SK DroRLeaf1 Citrus clementina cDNA clone C05075E02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295747 ID=CX295747|Name=CX295747|organism=Citrus clementina|type=EST|length=732bp
ATCCGTTGACAAAAAACGTTGCCGAATCTGAGGATTCTAAATTTGGCAAT
AGGATTATGAAGGATGAAGAGGCTCTAAGAAGCTGTATAGGTGTGATCTC
AAGGCTCAACTTAGTTGAAAATGCTTAAGAAAAAGTAACATTGCTCGGTG
ATTCTGATTTCTGAGTTATAATGTTCGTAACAGCAAGTGGAGTTGACTTT
GACGAAATGGGATATGCCATGAGTAGATTCGAGATAGAATCTGAATTCTA
TGATGCTGCCGATACTGTCAATCAAGCTAGTAATAGTCGTAGCAAATTCA
AGAAACCCTTGAGTGCTTTAGACCATGAAATTGCCCAGCTCACGAAGCTG
AAATCGGAACCCAAGGAGCATTTTAGCAAAGAAGTACCTGGGAAGCGGCA
CTTGCCTGTTTCCACTGTGAAAATGTTGGCTGGTAGGGAAGGCAATTATT
CAGGAAGAGGGAGGTTCTCAGCTGCAGATTGTTGTCATATGCTTAGTAGA
TATTTGCCTGTTAATGGGCCCTGGCCTGTGGACCAGACAACTAGCCGAGC
ATATGTCTCTCAGTTTTCGGCTGATGGTTCTTTATTTGTTGCTGGATTTC
AGGCTAGTCAAATTAGAATCTATGATGTGGAGAGAGGTTGGAAAATACAG
AAAGACATTCTTGCTAAAAGTTTGCGTTGGACAGTCACAGATACATCTCT
TTCCCGGATCAGCGCATCTTGTTATGCAGCAT
back to top