CX295755

Overview
NameCX295755
Unique NameCX295755
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length681
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX295755 vs. ExPASy Swiss-Prot
Match: NAC72_ARATH (NAC domain-containing protein 72 OS=Arabidopsis thaliana GN=NAC072 PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 6.780e-74
Identity = 106/122 (86.89%), Postives = 115/122 (94.26%), Query Frame = 2
Query:    2 YLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVSGSGYWKATGTDKIITTEGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRLFEPSRKNGSSKVN 367
            YLCRKVAG HFSLQ+IG+IDLYKFDPW LPSKA+FGEKEWYFFSPRDRKYPNGSRPNRV+GSGYWKATGTDKIIT +GR+VGIKKALVFY GKAPKGTKTNWIMHEYRL E SR +GSSK++
Sbjct:   31 YLCRKVAGYHFSLQVIGDIDLYKFDPWDLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITADGRRVGIKKALVFYAGKAPKGTKTNWIMHEYRLIEHSRSHGSSKLD 152          

HSP 2 Score: 65.4698 bits (158), Expect = 6.780e-74
Identity = 35/71 (49.30%), Postives = 42/71 (59.15%), Query Frame = 3
Query:  456 QLDDWVLCRIYKKHSGSQKP-VSATSVXXXXXXXXXXXXXXXXHLDDVLESLPDIDDRFFALPRMNSLETL 665
            +LDDWVLCRIYKK SGSQ+  V+                     LDDVL+S P+I D+ F LPRMNSL T+
Sbjct:  150 KLDDWVLCRIYKKTSGSQRQAVTPVQACREEHSTNGSSSSSSSQLDDVLDSFPEIKDQSFNLPRMNSLRTI 220          
BLAST of CX295755 vs. ExPASy Swiss-Prot
Match: NAC55_ARATH (NAC domain-containing protein 55 OS=Arabidopsis thaliana GN=NAC055 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 2.326e-68
Identity = 106/122 (86.89%), Postives = 117/122 (95.90%), Query Frame = 2
Query:    2 YLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVSGSGYWKATGTDKIITTEGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRLFEPSRKNGSSKVN 367
            YLCRK AG  FSLQ+I EIDLYKFDPWVLPSKA+FGEKEWYFFSPRDRKYPNGSRPNRV+GSGYWKATGTDK+I+TEGR+VGIKKALVFY+GKAPKGTKTNWIMHEYRL EPSR+NGS+K++
Sbjct:   31 YLCRKAAGHDFSLQLIAEIDLYKFDPWVLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVISTEGRRVGIKKALVFYIGKAPKGTKTNWIMHEYRLIEPSRRNGSTKLD 152          

HSP 2 Score: 43.1282 bits (100), Expect = 2.326e-68
Identity = 28/71 (39.44%), Postives = 36/71 (50.70%), Query Frame = 3
Query:  456 QLDDWVLCRIYKKHSGSQKPV--SATSVXXXXXXXXXXXXXXXXHLDDVLESLPDIDDRF--FALPRMNSL 656
            +LDDWVLCRIYKK + +QK    +  +                   DDVLESL +ID+R   FA    N+L
Sbjct:  150 KLDDWVLCRIYKKQTSAQKQAYNNLMTSGREYSNNGSSTSSSSHQYDDVLESLHEIDNRSLGFAAGSSNAL 220          
BLAST of CX295755 vs. ExPASy Swiss-Prot
Match: NAC19_ARATH (NAC domain-containing protein 19 OS=Arabidopsis thaliana GN=NAC019 PE=1 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 2.326e-68
Identity = 105/122 (86.07%), Postives = 117/122 (95.90%), Query Frame = 2
Query:    2 YLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVSGSGYWKATGTDKIITTEGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRLFEPSRKNGSSKVN 367
            YLCRK AG  FSLQ+I EIDLYKFDPWVLP+KA+FGEKEWYFFSPRDRKYPNGSRPNRV+GSGYWKATGTDKII+TEG++VGIKKALVFY+GKAPKGTKTNWIMHEYRL EPSR+NGS+K++
Sbjct:   31 YLCRKAAGYDFSLQLIAEIDLYKFDPWVLPNKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIISTEGQRVGIKKALVFYIGKAPKGTKTNWIMHEYRLIEPSRRNGSTKLD 152          

HSP 2 Score: 45.8246 bits (107), Expect = 2.326e-68
Identity = 27/77 (35.06%), Postives = 38/77 (49.35%), Query Frame = 3
Query:  456 QLDDWVLCRIYKKHSGSQKPV---SATSVXXXXXXXXXXXXXXXXHLDDVLESL-PDIDDRFFALPRMNSLETLQQE 674
            +LDDWVLCRIYKK S +QK V      +                 H +DVL+S   +ID+R F     N + +L+ +
Sbjct:  150 KLDDWVLCRIYKKQSSAQKQVYDNGIANAREFSNNGTSSTTSSSSHFEDVLDSFHQEIDNRNFQFSNPNRISSLRPD 226          
BLAST of CX295755 vs. ExPASy Swiss-Prot
Match: NAC48_ORYSJ (NAC domain-containing protein 48 OS=Oryza sativa subsp. japonica GN=NAC48 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 2.373e-49
Identity = 82/114 (71.93%), Postives = 92/114 (80.70%), Query Frame = 2
Query:    2 YLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVSGSGYWKATGTDKIITTEGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRLFEPSR 343
            YLCR+ AG   ++ II EIDLYKFDPW LP  A++GEKEWYFFSPRDRKYPNGSRPNR +GSGYWKATG DK + +  + V IKKALVFY GKAPKG KTNWIMHEYRL +  R
Sbjct:   26 YLCRRCAGLPIAVPIIAEIDLYKFDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGSP-KPVAIKKALVFYAGKAPKGEKTNWIMHEYRLADVDR 138          

HSP 2 Score: 39.2762 bits (90), Expect = 2.373e-49
Identity = 16/24 (66.67%), Postives = 19/24 (79.17%), Query Frame = 3
Query:  453 LQLDDWVLCRIYKKHSGSQKPVSA 524
            L+LDDWVLCRIY K  G +KP +A
Sbjct:  146 LRLDDWVLCRIYNKKGGLEKPPAA 169          
BLAST of CX295755 vs. ExPASy Swiss-Prot
Match: NAC2_ARATH (NAC domain-containing protein 2 OS=Arabidopsis thaliana GN=NAC002 PE=2 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 1.978e-48
Identity = 86/125 (68.80%), Postives = 96/125 (76.80%), Query Frame = 2
Query:    2 YLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVSGSGYWKATGTDKIITTEGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRLFEPSRKNGSSKVNTKL 376
            YLCRK A Q  ++ II EIDLYK+DPW LP  A++GEKEWYFFSPRDRKYPNGSRPNR +GSGYWKATG DK I    + VGIKKALVFY GKAPKG KTNWIMHEYRL +  R     K + +L
Sbjct:   24 YLCRKCASQSIAVPIIAEIDLYKYDPWELPGLALYGEKEWYFFSPRDRKYPNGSRPNRSAGSGYWKATGADKPIGLP-KPVGIKKALVFYAGKAPKGEKTNWIMHEYRLADVDRSVRKKKNSLRL 147          

HSP 2 Score: 33.113 bits (74), Expect = 1.978e-48
Identity = 12/20 (60.00%), Postives = 16/20 (80.00%), Query Frame = 3
Query:  453 LQLDDWVLCRIYKKHSGSQK 512
            L+LDDWVLCRIY K   +++
Sbjct:  145 LRLDDWVLCRIYNKKGATER 164          
BLAST of CX295755 vs. ExPASy Swiss-Prot
Match: NAC68_ORYSJ (NAC domain-containing protein 68 OS=Oryza sativa subsp. japonica GN=NAC68 PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 3.356e-48
Identity = 86/127 (67.72%), Postives = 97/127 (76.38%), Query Frame = 2
Query:    2 YLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVSGSGYWKATGTDKIITTEG--RKVGIKKALVFYVGKAPKGTKTNWIMHEYRLFEPSRKNGSSKVNTKL 376
            YLCRKVA Q   + II E+DLYK DPW LP KA+FG KEWYFF+PRDRKYPNGSRPNR +G GYWKATG DK +  +G  R VGIKKALVFY GKAP+G KT+WIMHEYRL +  R  G  K + KL
Sbjct:   38 YLCRKVARQPLPVPIIAEVDLYKLDPWDLPEKALFGRKEWYFFTPRDRKYPNGSRPNRAAGRGYWKATGADKPVAPKGSARTVGIKKALVFYSGKAPRGVKTDWIMHEYRLADADRAPGGKKGSQKL 164          

HSP 2 Score: 29.261 bits (64), Expect = 3.356e-48
Identity = 10/19 (52.63%), Postives = 15/19 (78.95%), Query Frame = 3
Query:  456 QLDDWVLCRIYKKHSGSQK 512
            +LD+WVLCR+Y K +  +K
Sbjct:  163 KLDEWVLCRLYNKKNNWEK 181          
BLAST of CX295755 vs. ExPASy Swiss-Prot
Match: NA102_ARATH (NAC domain-containing protein 102 OS=Arabidopsis thaliana GN=NAC102 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.370e-46
Identity = 80/122 (65.57%), Postives = 95/122 (77.87%), Query Frame = 2
Query:    2 YLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVSGSGYWKATGTDKIITTEGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRLFEPSRKNGSSKVN 367
            YLCR+ A +  ++ +I EIDLYKF+PW LP  A++GEKEWYFFS RDRKYPNGSRPNR +G+GYWKATG DK I  + + +GIKKALVFY GKAPKG KTNWIMHEYRL    R   ++K N
Sbjct:   67 YLCRRCASEPINVPVIAEIDLYKFNPWELPEMALYGEKEWYFFSHRDRKYPNGSRPNRAAGTGYWKATGADKPI-GKPKTLGIKKALVFYAGKAPKGIKTNWIMHEYRLANVDRSASTNKKN 187          

HSP 2 Score: 33.4982 bits (75), Expect = 1.370e-46
Identity = 14/26 (53.85%), Postives = 18/26 (69.23%), Query Frame = 3
Query:  453 LQLDDWVLCRIYKKHSGSQKPVSATS 530
            L+LDDWVLCRIY K    +K + A +
Sbjct:  189 LRLDDWVLCRIYNKKGTMEKYLPAAA 214          
BLAST of CX295755 vs. ExPASy Swiss-Prot
Match: NAC71_ORYSJ (NAC domain-containing protein 71 OS=Oryza sativa subsp. japonica GN=NAC71 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.284e-45
Identity = 78/122 (63.93%), Postives = 92/122 (75.41%), Query Frame = 2
Query:    2 YLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVSGSGYWKATGTDKIITTEGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRLFEPSRKNGSSKVN 367
            YLCRK  G   +  +I E+DLYKF+PW LP +A+ GEKEWYFFSPRDRKYPNG RPNR +G+GYWKATG DK + +  R V IKKALVFY GK PKG KTNWIMHEYRL +  R   + K++
Sbjct:   26 YLCRKCGGLPLAAPVIAEVDLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP-RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLS 146          

HSP 2 Score: 31.5722 bits (70), Expect = 4.284e-45
Identity = 12/14 (85.71%), Postives = 13/14 (92.86%), Query Frame = 3
Query:  453 LQLDDWVLCRIYKK 494
            L+LDDWVLCRIY K
Sbjct:  153 LRLDDWVLCRIYNK 166          
BLAST of CX295755 vs. ExPASy Swiss-Prot
Match: NAC67_ORYSJ (NAC domain-containing protein 67 OS=Oryza sativa subsp. japonica GN=NAC67 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.654e-44
Identity = 75/119 (63.03%), Postives = 91/119 (76.47%), Query Frame = 2
Query:    2 YLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVSGSGYWKATGTDKIITTEGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRLFEPSRKNGSS 358
            YLC + AG+   + II E+DLY+ DPW LP +A+FG +EWYFF+PRDRKYPNGSRPNR + SGYWKATG DK +   GR  GIKKALVFY GK P+G KT WIMHEYRL   ++K G++
Sbjct:   34 YLCPRAAGRAAPVPIIAELDLYRHDPWDLPHRALFGRREWYFFTPRDRKYPNGSRPNRAAASGYWKATGADKPVLHNGRTAGIKKALVFYHGKPPRGVKTEWIMHEYRL---AKKGGAA 149          

HSP 2 Score: 31.5722 bits (70), Expect = 4.654e-44
Identity = 12/20 (60.00%), Postives = 16/20 (80.00%), Query Frame = 3
Query:  453 LQLDDWVLCRIYKKHSGSQK 512
            L+LDDWVLCR+Y K +  +K
Sbjct:  157 LRLDDWVLCRLYNKKNEWEK 176          
BLAST of CX295755 vs. ExPASy Swiss-Prot
Match: NAC29_ARATH (NAC domain-containing protein 29 OS=Arabidopsis thaliana GN=NAC029 PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 1.455e-42
Identity = 74/126 (58.73%), Postives = 92/126 (73.02%), Query Frame = 2
Query:    2 YLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVSGSGYWKATGTDKIITTEGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRLFE----PSRKNGSSKVN 367
            YL  +   +   + II E+D+YKFDPW LP K  FGE EWYFFSPR+RKYPNG RPNR + SGYWKATGTDK I +    VG+KKALVFY G+ PKG KT+WIMHEYRL +     +++NGS +++
Sbjct:   26 YLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKTEFGENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSNVGVKKALVFYKGRPPKGIKTDWIMHEYRLHDSRKASTKRNGSMRLD 151          

HSP 2 Score: 33.113 bits (74), Expect = 1.455e-42
Identity = 12/19 (63.16%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  453 LQLDDWVLCRIYKKHSGSQ 509
            ++LD+WVLCRIYKK   S+
Sbjct:  148 MRLDEWVLCRIYKKRGASK 166          
The following BLAST results are available for this feature:
BLAST of CX295755 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 33
Match NameE-valueIdentityDescription
NAC72_ARATH6.780e-7486.89NAC domain-containing protein 72 OS=Arabidopsis th... [more]
NAC55_ARATH2.326e-6886.89NAC domain-containing protein 55 OS=Arabidopsis th... [more]
NAC19_ARATH2.326e-6886.07NAC domain-containing protein 19 OS=Arabidopsis th... [more]
NAC48_ORYSJ2.373e-4971.93NAC domain-containing protein 48 OS=Oryza sativa s... [more]
NAC2_ARATH1.978e-4868.80NAC domain-containing protein 2 OS=Arabidopsis tha... [more]
NAC68_ORYSJ3.356e-4867.72NAC domain-containing protein 68 OS=Oryza sativa s... [more]
NA102_ARATH1.370e-4665.57NAC domain-containing protein 102 OS=Arabidopsis t... [more]
NAC71_ORYSJ4.284e-4563.93NAC domain-containing protein 71 OS=Oryza sativa s... [more]
NAC67_ORYSJ4.654e-4463.03NAC domain-containing protein 67 OS=Oryza sativa s... [more]
NAC29_ARATH1.455e-4258.73NAC domain-containing protein 29 OS=Arabidopsis th... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05075E10SK DroRLeaf1 Citrus clementina cDNA clone C05075E10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295755 ID=CX295755|Name=CX295755|organism=Citrus clementina|type=EST|length=681bp
ATATCTCTGTCGCAAAGTTGCAGGGCAACATTTTTCGCTGCAAATTATCG
GTGAAATAGATTTGTACAAGTTTGACCCATGGGTTCTACCAAGCAAGGCA
ATTTTTGGTGAGAAAGAATGGTACTTTTTCAGCCCCAGGGATAGAAAATA
TCCAAACGGGTCCCGACCCAACAGAGTATCCGGGTCCGGGTATTGGAAGG
CCACAGGCACCGACAAGATTATCACAACTGAAGGTCGTAAGGTTGGTATC
AAAAAGGCTCTTGTTTTTTACGTAGGCAAAGCTCCAAAAGGCACCAAAAC
CAATTGGATCATGCACGAATATCGACTCTTTGAACCTTCTCGCAAAAATG
GCAGCTCCAAGGTAAATACAAAATTACCCGTATGCCCTGCTCTTCATATT
ATTAACTAGCTTAATCACCCTCTTTAACAAGTTAATTGGGTTTTGTTTAT
TTTTGCAGTTAGATGATTGGGTTCTGTGCAGAATCTATAAGAAGCATTCA
GGTTCCCAAAAACCAGTGTCAGCAACAAGTGTTTCTTCAAGCAAAGAACA
CAGTAATGGTTCTTGTTCATCTTCATCTTCTCATCTTGATGATGTGCTCG
AGTCTTTACCTGACATTGATGACCGATTTTTCGCTTTGCCACGCATGAAC
TCACTCGAGACTTTACAGCAAGAAGACAACA
back to top