CX295756

Overview
NameCX295756
Unique NameCX295756
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length672
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX295756 vs. ExPASy Swiss-Prot
Match: THIC2_ARATH (Probable acetyl-CoA acetyltransferase, cytosolic 2 OS=Arabidopsis thaliana GN=At5g47720 PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.181e-51
Identity = 115/183 (62.84%), Postives = 125/183 (68.31%), Query Frame = 2
Query:   35 VSDGAAALVLVSGVKVLELGLQVIAKIRGFADAAQAPEWFTTAPSLVIPKAIANAGLEASQIDYYEINEAFSVRNHVPT**CR*YPKVSLLPFHVLTSSLQVVAIANQKLLGLDPEQVNAHGGAVSLGHPLGCSGARILVTLLGVLRHKKXXXXXXXXXXXXXXASALVLELMQAVRVGHSKL 583
            +SDGAAALVLVSG K LELGL VIAKIRG+ADAAQAPE FTT P+L IPKAI  AGL+ASQ+DYYEINEAFS                             VVA+ANQKLLGLDPE++NAHGGAVSLGHPLGCSGARILVTLLGVLR KK              ASALVLE M    +G+S L
Sbjct:  262 ISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTTPALAIPKAIKRAGLDASQVDYYEINEAFS-----------------------------VVALANQKLLGLDPERLNAHGGAVSLGHPLGCSGARILVTLLGVLRAKKGKYGVASICNGGGGASALVLEFMSEKTIGYSAL 415          
BLAST of CX295756 vs. ExPASy Swiss-Prot
Match: THIC1_ARATH (Acetyl-CoA acetyltransferase, cytosolic 1 OS=Arabidopsis thaliana GN=AAT1 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.264e-45
Identity = 100/173 (57.80%), Postives = 120/173 (69.36%), Query Frame = 2
Query:   35 VSDGAAALVLVSGVKVLELGLQVIAKIRGFADAAQAPEWFTTAPSLVIPKAIANAGLEASQIDYYEINEAFSVRNHVPT**CR*YPKVSLLPFHVLTSSLQVVAIANQKLLGLDPEQVNAHGGAVSLGHPLGCSGARILVTLLGVLRHKKXXXXXXXXXXXXXXASALVLELM 553
            +SDGAAALVLVSG K L+LGL V+AKI+G+ DAAQ PE+FTTAP+L IPKAIA+AGLE+SQ+DYYEINEAF+                             VVA+ANQKLLG+ PE+VN +GGAVSLGHPLGCSGARIL+TLLG+L+ +               ASALVLEL+
Sbjct:  260 ISDGAAALVLVSGEKALQLGLLVLAKIKGYGDAAQEPEFFTTAPALAIPKAIAHAGLESSQVDYYEINEAFA-----------------------------VVALANQKLLGIAPEKVNVNGGAVSLGHPLGCSGARILITLLGILKKRNGKYGVGGVCNGGGGASALVLELL 403          
BLAST of CX295756 vs. ExPASy Swiss-Prot
Match: THIL_SCHPO (Acetyl-CoA acetyltransferase OS=Schizosaccharomyces pombe GN=erg10 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.643e-35
Identity = 83/171 (48.54%), Postives = 108/171 (63.16%), Query Frame = 2
Query:   35 VSDGAAALVLVSGVKVLELGLQVIAKIRGFADAAQAPEWFTTAPSLVIPKAIANAGLEASQIDYYEINEAFSVRNHVPT**CR*YPKVSLLPFHVLTSSLQVVAIANQKLLGLDPEQVNAHGGAVSLGHPLGCSGARILVTLLGVLRHKKXXXXXXXXXXXXXXASALVLE 547
            ++DGA+ALVL+S  KV ELGL+ +AKI G+ +AAQ PE FTT+PSL IPKA+ +AG+EASQ+DYYEINEAFS                             VVA+AN K+LGLDPE+VN +GG V++GHPLG SG+RI+ TL  +L  K               AS++V+E
Sbjct:  252 LNDGASALVLMSAAKVKELGLKPLAKIIGWGEAAQDPERFTTSPSLAIPKALKHAGIEASQVDYYEINEAFS-----------------------------VVAVANTKILGLDPERVNINGGGVAMGHPLGSSGSRIICTLAYILAQKDAKIGVAAVCNGGGGASSIVIE 393          
BLAST of CX295756 vs. ExPASy Swiss-Prot
Match: THIA_CANTR (Acetyl-CoA acetyltransferase IA OS=Candida tropicalis GN=PACTA PE=1 SV=3)

HSP 1 Score: 128.642 bits (322), Expect = 2.830e-29
Identity = 72/175 (41.14%), Postives = 104/175 (59.43%), Query Frame = 2
Query:   35 VSDGAAALVLVSGVKVLELGLQVIAKIRGFADAAQAPEWFTTAPSLVIPKAIANAGLEASQIDYYEINEAFSVRNHVPT**CR*YPKVSLLPFHVLTSSLQVVAIANQKLLGLDPEQVNAHGGAVSLGHPLGCSGARILVTLLGVLRHKKXXXXXXXXXXXXXXASALVLELMQA 559
            ++DG AALVLVS  K+ +LGL+ +AKI G+ +AA+ P  FT AP+L +PKA+ +AGL   ++D++E+NEAFS                             VV +AN +L+ +  E++N +GGAV++GHPLGCSGARI+VTLL VL  +               ASA+V+E + A
Sbjct:  254 LNDGGAALVLVSEAKLKQLGLKPLAKISGWGEAARTPFDFTIAPALAVPKAVKHAGLTVDRVDFFELNEAFS-----------------------------VVGLANAELVNIPLEKLNVYGGAVAMGHPLGCSGARIIVTLLSVLTQEGGRFGVAGVCNGGGGASAVVIEKIDA 399          
BLAST of CX295756 vs. ExPASy Swiss-Prot
Match: THIB_CANTR (Acetyl-CoA acetyltransferase IB OS=Candida tropicalis GN=PACTB PE=1 SV=3)

HSP 1 Score: 127.102 bits (318), Expect = 8.234e-29
Identity = 71/171 (41.52%), Postives = 102/171 (59.65%), Query Frame = 2
Query:   35 VSDGAAALVLVSGVKVLELGLQVIAKIRGFADAAQAPEWFTTAPSLVIPKAIANAGLEASQIDYYEINEAFSVRNHVPT**CR*YPKVSLLPFHVLTSSLQVVAIANQKLLGLDPEQVNAHGGAVSLGHPLGCSGARILVTLLGVLRHKKXXXXXXXXXXXXXXASALVLE 547
            ++DG AALVLVS  K+ +LGL+ +AKI G+ +AA+ P  FT AP+L +PKA+ +AGL   ++D++E+NEAFS                             VV +AN +L+ +  E++N +GGAV++GHPLGCSGARI+VTLL VL  +               ASA+V+E
Sbjct:  254 LNDGGAALVLVSEAKLKQLGLKPLAKISGWGEAARTPFDFTIAPALAVPKAVKHAGLTVDRVDFFELNEAFS-----------------------------VVGLANAELVKIPLEKLNVYGGAVAMGHPLGCSGARIIVTLLSVLTQEGGRFGAAGVCNGGGGASAIVIE 395          
BLAST of CX295756 vs. ExPASy Swiss-Prot
Match: THIL1_DICDI (Probable acetyl-CoA acetyltransferase OS=Dictyostelium discoideum GN=DDB_G0271544 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.189e-27
Identity = 70/171 (40.94%), Postives = 101/171 (59.06%), Query Frame = 2
Query:   35 VSDGAAALVLVSGVKVLELGLQVIAKIRGFADAAQAPEWFTTAPSLVIPKAIANAGLEASQIDYYEINEAFSVRNHVPT**CR*YPKVSLLPFHVLTSSLQVVAIANQKLLGLDPEQVNAHGGAVSLGHPLGCSGARILVTLLGVLRHKKXXXXXXXXXXXXXXASALVLE 547
            ++DGA++++L+S     ELGL+ +A+I G+ADA QAP  F TAP+L IPKA+ NAG+  SQ+D +EINEAF+                             VV +AN K+L +D  ++N +GGAV+LGHP+G SG RI+VTL  +L++K               ++ALVLE
Sbjct:  271 LNDGASSVILMSESHAKELGLKPLARIIGYADAEQAPIEFPTAPALAIPKALKNAGINMSQVDLFEINEAFA-----------------------------VVGLANAKILDIDHNKLNVNGGAVALGHPIGSSGCRIVVTLTHLLQNKNLKYGVAAICNGGGGSTALVLE 412          
BLAST of CX295756 vs. ExPASy Swiss-Prot
Match: THIL_YEAST (Acetyl-CoA acetyltransferase OS=Saccharomyces cerevisiae GN=ERG10 PE=1 SV=3)

HSP 1 Score: 122.865 bits (307), Expect = 1.553e-27
Identity = 70/172 (40.70%), Postives = 100/172 (58.14%), Query Frame = 2
Query:   35 VSDGAAALVLVSGVKVLELGLQVIAKIRGFADAAQAPEWFTTAPSLVIPKAIANAGLE-ASQIDYYEINEAFSVRNHVPT**CR*YPKVSLLPFHVLTSSLQVVAIANQKLLGLDPEQVNAHGGAVSLGHPLGCSGARILVTLLGVLRHKKXXXXXXXXXXXXXXASALVLE 547
            ++DGAAA++LVS   + E  L+ +A I+G+ +AA  P  FT APSL +PKA+ +AG+E  + +DY+E NEAFS                             VV + N K+L LDP +VN +GGAV+LGHPLGCSGAR++VTLL +L+ +               AS++V+E
Sbjct:  254 INDGAAAVILVSEKVLKEKNLKPLAIIKGWGEAAHQPADFTWAPSLAVPKALKHAGIEDINSVDYFEFNEAFS-----------------------------VVGLVNTKILKLDPSKVNVYGGAVALGHPLGCSGARVVVTLLSILQQEGGKIGVAAICNGGGGASSIVIE 396          
BLAST of CX295756 vs. ExPASy Swiss-Prot
Match: THIL_SACBA (Acetyl-CoA acetyltransferase OS=Saccharomyces bayanus GN=ERG10 PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.649e-27
Identity = 69/172 (40.12%), Postives = 100/172 (58.14%), Query Frame = 2
Query:   35 VSDGAAALVLVSGVKVLELGLQVIAKIRGFADAAQAPEWFTTAPSLVIPKAIANAGLE-ASQIDYYEINEAFSVRNHVPT**CR*YPKVSLLPFHVLTSSLQVVAIANQKLLGLDPEQVNAHGGAVSLGHPLGCSGARILVTLLGVLRHKKXXXXXXXXXXXXXXASALVLE 547
            ++DGAAA++LVS   + E  L+ +A ++G+ +AA  P  FT APSL +PKA+ +AG+E  + +DY+E NEAFS                             VV + N K+L LDP +VN +GGAV+LGHPLGCSGAR++VTLL +L+ +               AS++V+E
Sbjct:  254 INDGAAAIILVSERVLKEKNLKPLAIVKGWGEAAHLPADFTWAPSLAVPKALKHAGIEDINSVDYFEFNEAFS-----------------------------VVGLVNTKILKLDPSKVNVYGGAVALGHPLGCSGARVVVTLLSILQQEGGKIGVAAICNGGGGASSVVIE 396          
BLAST of CX295756 vs. ExPASy Swiss-Prot
Match: THIL_YARLI (Acetyl-CoA acetyltransferase OS=Yarrowia lipolytica GN=PAT1 PE=3 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.099e-24
Identity = 67/147 (45.58%), Postives = 83/147 (56.46%), Query Frame = 2
Query:   35 VSDGAAALVLVSGVKVLELGLQVIAKIRGFADAAQAPEWFTTAPSLVIPKAIANAGLEASQIDYYEINEAFSVRNHVPT**CR*YPKVSLLPFHVLTSSLQVVAIANQKLLGLDPEQVNAHGGAVSLGHPLGCSGARILVTLLGVLR 475
            ++DGA+A+V+ SG K  ELG  V+AKI  +ADAA AP  FT APSL IP A+  AGL    I  +EINEAFS                              VA+AN   LG+D  +VN  GGAV+LGHP+G SG RI VTL+  L+
Sbjct:  252 INDGASAVVVASGTKAKELGTPVLAKIVSYADAATAPIDFTIAPSLAIPAALKKAGLTKDDIALWEINEAFS-----------------------------GVALANLMRLGIDKSKVNVKGGAVALGHPIGASGNRIFVTLVNALK 369          
BLAST of CX295756 vs. ExPASy Swiss-Prot
Match: THIL_MOUSE (Acetyl-CoA acetyltransferase, mitochondrial OS=Mus musculus GN=Acat1 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.749e-22
Identity = 60/147 (40.82%), Postives = 83/147 (56.46%), Query Frame = 2
Query:   35 VSDGAAALVLVSGVKVLELGLQVIAKIRGFADAAQAPEWFTTAPSLVIPKAIANAGLEASQIDYYEINEAFSVRNHVPT**CR*YPKVSLLPFHVLTSSLQVVAIANQKLLGLDPEQVNAHGGAVSLGHPLGCSGARILVTLLGVLR 475
            ++DGAAALVL++      L ++ +A+I  FADAA  P  F  AP+  +PK +  AGL+   I  +E+NEAFS                             VV +AN K+L +DP++VN HGGAVSLGHP+G SGARI+V +   L+
Sbjct:  283 LNDGAAALVLMTAEAAQRLNVKPLARIAAFADAAVDPIDFPLAPAYAVPKVLKYAGLKKEDIAMWEVNEAFS-----------------------------VVVLANIKMLEIDPQKVNIHGGAVSLGHPIGMSGARIVVHMAHALK 400          
The following BLAST results are available for this feature:
BLAST of CX295756 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 146
Match NameE-valueIdentityDescription
THIC2_ARATH1.181e-5162.84Probable acetyl-CoA acetyltransferase, cytosolic 2... [more]
THIC1_ARATH1.264e-4557.80Acetyl-CoA acetyltransferase, cytosolic 1 OS=Arabi... [more]
THIL_SCHPO2.643e-3548.54Acetyl-CoA acetyltransferase OS=Schizosaccharomyce... [more]
THIA_CANTR2.830e-2941.14Acetyl-CoA acetyltransferase IA OS=Candida tropica... [more]
THIB_CANTR8.234e-2941.52Acetyl-CoA acetyltransferase IB OS=Candida tropica... [more]
THIL1_DICDI1.189e-2740.94Probable acetyl-CoA acetyltransferase OS=Dictyoste... [more]
THIL_YEAST1.553e-2740.70Acetyl-CoA acetyltransferase OS=Saccharomyces cere... [more]
THIL_SACBA2.649e-2740.12Acetyl-CoA acetyltransferase OS=Saccharomyces baya... [more]
THIL_YARLI2.099e-2445.58Acetyl-CoA acetyltransferase OS=Yarrowia lipolytic... [more]
THIL_MOUSE9.749e-2240.82Acetyl-CoA acetyltransferase, mitochondrial OS=Mus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05075E11SK DroRLeaf1 Citrus clementina cDNA clone C05075E11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295756 ID=CX295756|Name=CX295756|organism=Citrus clementina|type=EST|length=672bp
CTTATCAGTTTTGGGTTGTTGGTCTACTGTTGTGGTCAGTGATGGTGCAG
CAGCACTTGTACTGGTGAGTGGAGTGAAGGTGCTTGAGCTTGGTTTGCAA
GTAATAGCTAAGATTAGGGGATTTGCTGACGCAGCTCAGGCTCCAGAGTG
GTTTACAACTGCTCCATCCCTTGTAATACCAAAAGCCATAGCAAATGCTG
GCTTGGAAGCTTCTCAGATTGATTACTATGAAATAAACGAAGCTTTTTCT
GTAAGAAATCATGTTCCTACCTAGTGATGCCGCTAGTATCCAAAGGTTAG
TTTATTACCATTTCATGTTCTAACCTCCTCTTTGCAGGTTGTAGCTATTG
CCAATCAAAAACTGCTTGGTCTTGATCCTGAACAGGTTAATGCGCATGGT
GGAGCCGTATCCCTGGGTCATCCGTTAGGGTGTAGTGGAGCTCGTATCTT
GGTCACATTATTGGGGGTACTGAGACATAAGAAGGGGAAGTACGGGGTTG
GTGGCATCTGCAATGGTGGAGGGGGGGCATCCGCTCTTGTTCTTGAGCTC
ATGCAAGCGGTGCGGGTGGGACATTCCAAGCTATGAATTGATGATGTGTA
CTGACTGTGGAACATCACCTCCTGTGCTATTGTCTCTTATCTCTTTGTTA
AGTTGTCTACTTGAATGAGAAA
back to top