CX295767

Overview
NameCX295767
Unique NameCX295767
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length692
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1037 contig Ccv1_Contig1037:25..716. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX295767 vs. ExPASy Swiss-Prot
Match: UBC4_SOLLC (Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 6.828e-82
Identity = 143/148 (96.62%), Postives = 146/148 (98.65%), Query Frame = 2
Query:   56 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 499
            MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGP+DSP+AGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPTDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 148          
BLAST of CX295767 vs. ExPASy Swiss-Prot
Match: UBC28_ARATH (Ubiquitin carrier protein E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 5.780e-81
Identity = 140/148 (94.59%), Postives = 146/148 (98.65%), Query Frame = 2
Query:   56 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 499
            MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGPSDSP++GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPN+NSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE+TARSWTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148          
BLAST of CX295767 vs. ExPASy Swiss-Prot
Match: UBC10_ARATH (Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 6.390e-80
Identity = 139/148 (93.92%), Postives = 145/148 (97.97%), Query Frame = 2
Query:   56 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 499
            MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGPS+SP+AGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD+ KYE+TARSWTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARSWTQKYAMG 148          
BLAST of CX295767 vs. ExPASy Swiss-Prot
Match: UBC8_ARATH (Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 8.346e-80
Identity = 138/148 (93.24%), Postives = 145/148 (97.97%), Query Frame = 2
Query:   56 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 499
            MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGP++SP++GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE TAR+WTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYEATARNWTQKYAMG 148          
BLAST of CX295767 vs. ExPASy Swiss-Prot
Match: UBC9_ARATH (SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 1.090e-79
Identity = 138/148 (93.24%), Postives = 145/148 (97.97%), Query Frame = 2
Query:   56 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 499
            MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGPSDSP++GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD+ KYE+TAR+WTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARTWTQKYAMG 148          
BLAST of CX295767 vs. ExPASy Swiss-Prot
Match: UBC11_ARATH (Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=2 SV=2)

HSP 1 Score: 294.278 bits (752), Expect = 4.142e-79
Identity = 136/148 (91.89%), Postives = 146/148 (98.65%), Query Frame = 2
Query:   56 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 499
            MASKRI KELKDLQKDPP++CSAGPVA+DMFHWQATIMGP +SP+AGGVFLVSIHFPPDYPFKPPKV+F+TKV+HPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR+KYE+TARSWTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPSNCSAGPVAEDMFHWQATIMGPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAMG 148          
BLAST of CX295767 vs. ExPASy Swiss-Prot
Match: UBC30_ARATH (Ubiquitin carrier protein E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 1.574e-78
Identity = 134/148 (90.54%), Postives = 143/148 (96.62%), Query Frame = 2
Query:   56 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 499
            MASKRINKEL+DLQ+DPP SCSAGP  DDMF WQATIMGP+DSPFAGGVFLV+IHFPPDYPFKPPKVAFRTKV+HPNINSNGSICLDILKEQWSPALT+SKVLLSICSLLTDPNPDDPLVPEIAH+YKTDR KYE+TA+SWTQKYAMG
Sbjct:    1 MASKRINKELRDLQRDPPVSCSAGPTGDDMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHIYKTDRVKYESTAQSWTQKYAMG 148          
BLAST of CX295767 vs. ExPASy Swiss-Prot
Match: UBC29_ARATH (Ubiquitin carrier protein E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.525e-73
Identity = 124/147 (84.35%), Postives = 139/147 (94.56%), Query Frame = 2
Query:   56 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 496
            MA++RI KELK+LQ+DPP SCSAGP  +DMFHWQATIMGP++SP++GGVFLV+IHFPPDYPFKPPKV FRTKVFHPNINSNG+ICLDILK+QWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH+YKTD+ KYE  ARSWTQKYA+
Sbjct:    1 MATRRILKELKELQRDPPVSCSAGPTGEDMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHIYKTDKTKYEAMARSWTQKYAL 147          
BLAST of CX295767 vs. ExPASy Swiss-Prot
Match: UBC4_SCHPO (Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe GN=ubc4 PE=2 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 4.152e-71
Identity = 120/147 (81.63%), Postives = 137/147 (93.20%), Query Frame = 2
Query:   56 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 496
            MA KRIN+EL DL KDPP+SCSAGPV DD+FHWQATIMGP+DSP+AGGVF +SIHFP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH+YKTDR++YE +AR WT+KYA+
Sbjct:    1 MALKRINRELADLGKDPPSSCSAGPVGDDLFHWQATIMGPADSPYAGGVFFLSIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHVYKTDRSRYELSAREWTRKYAI 147          
BLAST of CX295767 vs. ExPASy Swiss-Prot
Match: UBC1_MAGGR (Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnaporthe grisea GN=UBC1 PE=3 SV=2)

HSP 1 Score: 265.388 bits (677), Expect = 2.060e-70
Identity = 119/147 (80.95%), Postives = 137/147 (93.20%), Query Frame = 2
Query:   56 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 496
            MA KRINKEL DL +DPP+SCSAGPV +D+FHWQATIMGPSDSP+AGGVF ++IHFP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISKVLLSICS+LTDPNPDDPLVPEIAH+YKT RA+YE+TAR WT+KYA+
Sbjct:    1 MALKRINKELTDLGRDPPSSCSAGPVGEDLFHWQATIMGPSDSPYAGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTARAQYESTAREWTRKYAI 147          
The following BLAST results are available for this feature:
BLAST of CX295767 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBC4_SOLLC6.828e-8296.62Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum ... [more]
UBC28_ARATH5.780e-8194.59Ubiquitin carrier protein E2 28 OS=Arabidopsis tha... [more]
UBC10_ARATH6.390e-8093.92Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis ... [more]
UBC8_ARATH8.346e-8093.24Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis t... [more]
UBC9_ARATH1.090e-7993.24SUMO-conjugating enzyme UBC9 OS=Arabidopsis thalia... [more]
UBC11_ARATH4.142e-7991.89Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis ... [more]
UBC30_ARATH1.574e-7890.54Ubiquitin carrier protein E2 30 OS=Arabidopsis tha... [more]
UBC29_ARATH1.525e-7384.35Ubiquitin carrier protein E2 29 OS=Arabidopsis tha... [more]
UBC4_SCHPO4.152e-7181.63Ubiquitin-conjugating enzyme E2 4 OS=Schizosacchar... [more]
UBC1_MAGGR2.060e-7080.95Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnapor... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05075F10SK DroRLeaf1 Citrus clementina cDNA clone C05075F10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295767 ID=CX295767|Name=CX295767|organism=Citrus clementina|type=EST|length=692bp
GAGGATACACCAGACCCAAACTCTCAGGCCACAAAGTTTGTTGAGAAATT
CCCAGATGGCTTCAAAACGGATCAACAAGGAGTTGAAGGACCTACAGAAG
GACCCTCCTGCTTCTTGTAGCGCTGGCCCTGTTGCTGATGACATGTTCCA
TTGGCAAGCAACAATTATGGGCCCATCAGACAGCCCATTTGCTGGGGGTG
TATTTCTTGTATCCATTCATTTCCCACCTGATTATCCATTCAAGCCACCG
AAGGTGGCCTTCCGTACTAAGGTTTTCCACCCTAACATCAACAGCAATGG
TAGCATCTGTCTTGACATTCTCAAGGAGCAGTGGAGCCCTGCTTTGACAA
TATCCAAGGTACTTCTGTCAATTTGCTCACTACTTACTGATCCGAACCCA
GATGACCCACTTGTGCCTGAGATTGCTCACATGTACAAGACTGACAGAGC
CAAATATGAGACTACTGCTCGATCCTGGACCCAGAAGTATGCCATGGGTT
AAGAGGGGCTAGGCTGTACGCCCCTGAGAACATTAATGGCTTGTGGTCCT
ATTAGTAAATAATAGAAATAAGTTTGTTTCAGATATTAAAAGACGATATT
TGGTTTTGTTTACTAAGTTGTTAAAAGGTTTTATGTGGGGTTACTTTCCA
ATTTAGCATTGTCCTTCAATACTTAAATTATAATTTACTGCA
back to top