CX295784
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX295784 vs. ExPASy Swiss-Prot
Match: AIRE_HUMAN (Autoimmune regulator OS=Homo sapiens GN=AIRE PE=1 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 3.125e-13 Identity = 30/59 (50.85%), Postives = 40/59 (67.80%), Query Frame = 3 Query: 288 PFSSKENDDLCGICMDGGDLLCCDSCPRAFHIDCVSLP--GIPSGTWHCRYCMNTFQKE 458 P ++N+D C +C DGG+L+CCD CPRAFH+ C+S P IPSGTW C C+ +E Sbjct: 289 PQLHQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQE 347
BLAST of CX295784 vs. ExPASy Swiss-Prot
Match: AIRE_MOUSE (Autoimmune regulator OS=Mus musculus GN=Aire PE=1 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.025e-12 Identity = 28/53 (52.83%), Postives = 38/53 (71.70%), Query Frame = 3 Query: 288 PFSSKENDDLCGICMDGGDLLCCDSCPRAFHIDCVSLP--GIPSGTWHCRYCM 440 P +++N+D C +C DGG+L+CCD CPRAFH+ C+S P IPSG W C C+ Sbjct: 291 PQVNQKNEDECAVCHDGGELICCDGCPRAFHLACLSPPLQEIPSGLWRCSCCL 343
BLAST of CX295784 vs. ExPASy Swiss-Prot
Match: TRI33_XENLA (E3 ubiquitin-protein ligase TRIM33 OS=Xenopus laevis GN=trim33 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 5.893e-12 Identity = 40/119 (33.61%), Postives = 64/119 (53.78%), Query Frame = 3 Query: 225 HIYTSNGVSLHELSIKLSLERP--------FSSKE---NDDLCGICMDGGDLLCCDSCPRAFHIDC--VSLPGIPSGTWHCRYCMNTFQKEKFVEYNA----NARAAGRIEGVDPFAQM 530 H+ NG S +++ S+ RP S+K+ N+D C +C +GGDLLCC+ CP+ FH+ C +L PSG W C +C + + E VEY+ +++ ++G+ P QM Sbjct: 815 HVSLVNGKS----AVRNSMHRPPRGGGGGDGSNKDDDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGEWICTFCRDLNKPE--VEYDCDNSQHSKKGKTVQGLSPVDQM 927
BLAST of CX295784 vs. ExPASy Swiss-Prot
Match: TRI33_DANRE (E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio GN=trim33 PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 7.697e-12 Identity = 29/61 (47.54%), Postives = 38/61 (62.30%), Query Frame = 3 Query: 306 NDDLCGICMDGGDLLCCDSCPRAFHIDC--VSLPGIPSGTWHCRYCMNTFQKEKFVEYNAN 482 N+D C +C +GG+LLCCD CP+ FHI C +L PSG W C +C N E +EYN + Sbjct: 920 NEDWCAVCQNGGELLCCDHCPKVFHITCHIPTLKSSPSGDWMCTFCRNLANPE--IEYNCD 978
BLAST of CX295784 vs. ExPASy Swiss-Prot
Match: TIF1A_HUMAN (Transcription intermediary factor 1-alpha OS=Homo sapiens GN=TRIM24 PE=1 SV=3) HSP 1 Score: 67.3958 bits (163), Expect = 4.989e-11 Identity = 27/62 (43.55%), Postives = 40/62 (64.52%), Query Frame = 3 Query: 306 NDDLCGICMDGGDLLCCDSCPRAFHIDC--VSLPGIPSGTWHCRYCMNTFQKEKFVEYNANA 485 N+D C +C +GG+LLCC+ CP+ FH+ C +L PSG W C +C + + E VEY+ +A Sbjct: 825 NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPE--VEYDCDA 884
BLAST of CX295784 vs. ExPASy Swiss-Prot
Match: TRI66_HUMAN (Tripartite motif-containing protein 66 OS=Homo sapiens GN=TRIM66 PE=2 SV=4) HSP 1 Score: 66.6254 bits (161), Expect = 8.510e-11 Identity = 27/60 (45.00%), Postives = 38/60 (63.33%), Query Frame = 3 Query: 303 ENDDLCGICMDGGDLLCCDSCPRAFHIDC--VSLPGIPSGTWHCRYCMNTFQKEKFVEYN 476 EN+D C +C++GG+LLCCD CP+ FH+ C +L P G W C C + Q E +EY+ Sbjct: 968 ENEDFCAVCLNGGELLCCDRCPKVFHLSCHVPALLSFPGGEWVCTLCRSLTQPE--MEYD 1025 The following BLAST results are available for this feature:
BLAST of CX295784 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX295784 ID=CX295784; Name=CX295784; organism=Citrus clementina; type=EST; length=543bpback to top |