CX296270

Overview
NameCX296270
Unique NameCX296270
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length614
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig679 contig Ccv1_Contig679:1..614. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296270 vs. ExPASy Swiss-Prot
Match: TM165_HUMAN (Transmembrane protein 165 OS=Homo sapiens GN=TMEM165 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.953e-15
Identity = 47/100 (47.00%), Postives = 65/100 (65.00%), Query Frame = 2
Query:  314 SGLEVFDAFIASFSMIIVSEIGDETFIIAALMAMRHPKSTVLSGALSALFVMTVLSTGLGRIVPNLISRKHTNSAATVLYAFFGLRILYIAWMSDPKSGQ 613
            + L    AF+A+ S+IIVSE+GD+TF IAA+MAMR+ + TVL+GA+ AL +MT LS   G     +I R +T   +TVL+A FG+R+L       P  GQ
Sbjct:   89 TNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFG-YATTVIPRVYTYYVSTVLFAIFGIRMLREGLKMSPDEGQ 187          
BLAST of CX296270 vs. ExPASy Swiss-Prot
Match: TM165_RAT (Transmembrane protein 165 OS=Rattus norvegicus GN=Tmem165 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.352e-15
Identity = 46/100 (46.00%), Postives = 64/100 (64.00%), Query Frame = 2
Query:  314 SGLEVFDAFIASFSMIIVSEIGDETFIIAALMAMRHPKSTVLSGALSALFVMTVLSTGLGRIVPNLISRKHTNSAATVLYAFFGLRILYIAWMSDPKSGQ 613
            + L    AF+A+ S+IIVSE+GD+TF IAA+MAMR+ + TVL+GA+ AL +MT LS   G     +I R +T   +T L+A FG+R+L       P  GQ
Sbjct:   89 ANLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALALMTCLSVLFG-YATTVIPRVYTYYVSTALFAIFGIRMLREGLKMSPDEGQ 187          
BLAST of CX296270 vs. ExPASy Swiss-Prot
Match: TM165_MOUSE (Transmembrane protein 165 OS=Mus musculus GN=Tmem165 PE=2 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 4.352e-15
Identity = 46/100 (46.00%), Postives = 64/100 (64.00%), Query Frame = 2
Query:  314 SGLEVFDAFIASFSMIIVSEIGDETFIIAALMAMRHPKSTVLSGALSALFVMTVLSTGLGRIVPNLISRKHTNSAATVLYAFFGLRILYIAWMSDPKSGQ 613
            + L    AF+A+ S+IIVSE+GD+TF IAA+MAMR+ + TVL+GA+ AL +MT LS   G     +I R +T   +T L+A FG+R+L       P  GQ
Sbjct:   89 TNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALALMTCLSVLFG-YATTVIPRVYTYYVSTALFAIFGIRMLREGLKMSPDEGQ 187          
BLAST of CX296270 vs. ExPASy Swiss-Prot
Match: YD68_SCHPO (UPF0016 membrane protein C17G8.08c OS=Schizosaccharomyces pombe GN=SPAC17G8.08c PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.185e-12
Identity = 38/81 (46.91%), Postives = 53/81 (65.43%), Query Frame = 2
Query:  335 AFIASFSMIIVSEIGDETFIIAALMAMRHPKSTVLSGALSALFVMTVLSTGLGRIVPNLISRKHTNSAATVLYAFFGLRIL 577
            + I S SMI   EIGD+TFI+AAL+A  + + TV +G+ SALF+MT+L   LG   P L  RK T+    VL+  FG+++L
Sbjct:   49 SLIFSISMIFGCEIGDKTFIVAALLAFENSRLTVFAGSYSALFIMTLLGVLLGHAAPLLFPRKLTDILGGVLFVIFGIKML 129          
BLAST of CX296270 vs. ExPASy Swiss-Prot
Match: YB37_YEAST (UPF0016 membrane protein YBR187W OS=Saccharomyces cerevisiae GN=YBR187W PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.003e-11
Identity = 36/80 (45.00%), Postives = 54/80 (67.50%), Query Frame = 2
Query:  335 AFIASFSMIIVSEIGDETFIIAALMAMRHPKSTVLSGALSALFVMTVLSTGLGRIVPNLISRKHTNSAATVLYAFFGLRI 574
            +F+ S SMI +SEIGD+TF+IAALMAMRH +  V S A ++L +MT+LS  +G      +S ++T   A +L+  FG ++
Sbjct:   41 SFLMSVSMIGLSEIGDKTFLIAALMAMRHKRVLVFSAAATSLAIMTILSGVVGHSAVAFLSERYTAFFAGILFLVFGYKL 120          
The following BLAST results are available for this feature:
BLAST of CX296270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
TM165_HUMAN1.953e-1547.00Transmembrane protein 165 OS=Homo sapiens GN=TMEM1... [more]
TM165_RAT4.352e-1546.00Transmembrane protein 165 OS=Rattus norvegicus GN=... [more]
TM165_MOUSE4.352e-1546.00Transmembrane protein 165 OS=Mus musculus GN=Tmem1... [more]
YD68_SCHPO1.185e-1246.91UPF0016 membrane protein C17G8.08c OS=Schizosaccha... [more]
YB37_YEAST1.003e-1145.00UPF0016 membrane protein YBR187W OS=Saccharomyces ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05138B07SK FerrChloL1 Citrus clementina cDNA clone C05138B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296270 ID=CX296270|Name=CX296270|organism=Citrus clementina|type=EST|length=614bp
GGCAGAGGCCTCGTGCCGAATTCGGCACGAGGCCTCGTGCCGAATTCGGC
ACGAGGTTTCTCTCTGGCAGATCTGTTTGTTTCCCTCCAATTCTCTCTAA
ATTTACGACATGGGTTTGGTTTCAAACCCCGTCCGCTTTCTCTTCGTCGC
CCTTTCCATCTTCTCTGCTCTTTCTGGCATCTCTGCTCAGGACGTCCTTT
TTGAATCCGATAATGAAGACCCATCTCGATCTGCTAAAGATCTCGGCCGC
CGTGGCTTGATTTTATCGCAAGACCTTGAGAATGAACTCGGCACGATCCC
TTTGAATATCGACTCGGGTCTTGAAGTTTTTGATGCCTTCATCGCAAGTT
TTTCGATGATCATTGTTAGTGAGATTGGAGATGAGACTTTCATAATAGCA
GCACTTATGGCAATGCGTCATCCCAAGTCAACCGTTTTGTCGGGTGCGCT
CTCTGCTCTGTTTGTTATGACTGTACTTTCTACTGGACTAGGTAGGATTG
TGCCGAACTTGATATCAAGGAAGCATACAAATAGTGCTGCTACAGTTCTG
TATGCATTTTTTGGGCTGCGGATACTATACATAGCTTGGATGTCAGATCC
AAAATCAGGTCAGA
back to top