CX296277

Overview
NameCX296277
Unique NameCX296277
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length478
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3375 contig Ccv1_Contig3375:202..680. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296277 vs. ExPASy Swiss-Prot
Match: RAP23_ARATH (Ethylene-responsive transcription factor RAP2-3 OS=Arabidopsis thaliana GN=RAP2-3 PE=1 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 3.548e-22
Identity = 56/124 (45.16%), Postives = 74/124 (59.68%), Query Frame = 3
Query:  123 MCGGSILGDFFP---RHGGSRVTASDLWPNSPFAATKQLPHNFESTPFSDEHQSLAK---IKRPQPPSYLNSCSASGDEKKPKRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEE 476
            MCGG+I+ D+ P   +  G ++TA +LW     +A       + ++     +Q   K   +K+ Q             E   +R+RKN+YRGIR+RPWGKWAAEIRDPRKGVRVWLGTFNTAEE
Sbjct:    1 MCGGAIISDYAPLVTKAKGRKLTAEELWSELDASAADDFWGFYSTSKLHPTNQVNVKEEAVKKEQ-----------ATEPGKRRKRKNVYRGIRKRPWGKWAAEIRDPRKGVRVWLGTFNTAEE 113          
BLAST of CX296277 vs. ExPASy Swiss-Prot
Match: RAP22_ARATH (Ethylene-responsive transcription factor RAP2-2 OS=Arabidopsis thaliana GN=RAP2-2 PE=2 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 9.661e-20
Identity = 63/162 (38.89%), Postives = 80/162 (49.38%), Query Frame = 3
Query:  123 MCGGSILGDFFPRHGGSRVTASDLWP---NSPFAATKQ---------LPHNFEST----------PFSDEHQSLAKIK--------RPQPPSYLNSC--------------SASGDEKKPKRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEE 476
            MCGG+I+ DF P     RVT   +WP   N   A+ K+         L  +FE+              D+      +K        +P   +++++               SA   EK  KR+RKN YRGIRQRPWGKWAAEIRDPRKG R WLGTF+TAEE
Sbjct:    1 MCGGAIISDFIPPPRSLRVTNEFIWPDLKNKVKASKKRSNKRSDFFDLDDDFEADFQGFKDDSAFDCEDDDDVFVNVKPFVFTATTKPVASAFVSTGIYLVGSAYAKKTVESAEQAEKSSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTAEE 162          
BLAST of CX296277 vs. ExPASy Swiss-Prot
Match: ERF71_ARATH (Ethylene-responsive transcription factor ERF071 OS=Arabidopsis thaliana GN=ERF071 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.811e-19
Identity = 55/118 (46.61%), Postives = 67/118 (56.78%), Query Frame = 3
Query:  123 MCGGSILGDFFPRHGGSRVTASDLWPNSPFAATKQLPHNFESTPFSDEHQSLAKIKRPQPPSYLNSCSASGDEKKPKRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEE 476
            MCGG+I+ DF             +W  S            ES P   +  S++  K+ +P S         +E+  KR+RKNLYRGIRQRPWGKWAAEIRDP KGVRVWLGTF TA+E
Sbjct:    1 MCGGAIISDF-------------IWSKS------------ESEP--SQLGSVSSRKKRKPVSV-------SEERDGKRERKNLYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFKTADE 84          
BLAST of CX296277 vs. ExPASy Swiss-Prot
Match: RA212_ARATH (Ethylene-responsive transcription factor RAP2-12 OS=Arabidopsis thaliana GN=RAP2-12 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 4.795e-19
Identity = 61/159 (38.36%), Postives = 74/159 (46.54%), Query Frame = 3
Query:  123 MCGGSILGDFFPRHGGSRVTASDLWPN----------------------SPFAATKQLPHNFESTPFSDEHQS---LAKIKR---PQPPSYLNSCSASGD-------------EKKPKRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEE 476
            MCGG+I+ DF P     RVT+  +WP+                      + F A  Q   +  S    D+       A +K       P    S +A G              EK   R+RKN YRGIRQRPWGKWAAEIRDPR+G R+WLGTF TAEE
Sbjct:    1 MCGGAIISDFIPPPRSRRVTSEFIWPDLKKNLKGSKKSSKNRSNFFDFDAEFEADFQGFKDDSSIDCDDDFDVGDVFADVKPFVFTSTPKPAVSAAAEGSVFGKKVTGLDGDAEKSANRKRKNQYRGIRQRPWGKWAAEIRDPREGARIWLGTFKTAEE 159          
BLAST of CX296277 vs. ExPASy Swiss-Prot
Match: ERF1_ORYSJ (Ethylene-responsive transcription factor 1 OS=Oryza sativa subsp. japonica GN=EREBP1 PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 6.924e-18
Identity = 44/70 (62.86%), Postives = 52/70 (74.29%), Query Frame = 3
Query:  279 AKIKRPQPPSYLNSCSASGDE----KKPKRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEE 476
            A  KR      L++ + +G +    K  KR+RKN +RGIRQRPWGKWAAEIRDPRKGVRVWLGTFN+AEE
Sbjct:   85 AAFKRALSRDNLSTITTAGFDGPAAKSAKRKRKNQFRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNSAEE 154          
BLAST of CX296277 vs. ExPASy Swiss-Prot
Match: EF112_ARATH (Ethylene-responsive transcription factor ERF112 OS=Arabidopsis thaliana GN=ERF112 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.222e-14
Identity = 37/73 (50.68%), Postives = 49/73 (67.12%), Query Frame = 3
Query:  258 SDEHQSLAKIKRPQPPSYLNSCSASGDEKKPKRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEE 476
            SD    ++++     PS ++  S+S   ++    R+  YRG+RQRPWGKWAAEIRDP K  RVWLGTF+TAEE
Sbjct:   32 SDVSDFVSELTGQPIPSSIDDQSSSLTLQEKSNSRQRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEE 104          
BLAST of CX296277 vs. ExPASy Swiss-Prot
Match: ERF73_ARATH (Ethylene-responsive transcription factor ERF073 OS=Arabidopsis thaliana GN=ERF073 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.723e-14
Identity = 33/48 (68.75%), Postives = 40/48 (83.33%), Query Frame = 3
Query:  333 GDEKKPKRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEE 476
            G     K+++ + Y+GIR+RPWG+WAAEIRDP KGVRVWLGTFNTAEE
Sbjct:   12 GSASDGKKKQSSRYKGIRRRPWGRWAAEIRDPIKGVRVWLGTFNTAEE 59          
BLAST of CX296277 vs. ExPASy Swiss-Prot
Match: EF113_ARATH (Ethylene-responsive transcription factor ERF113 OS=Arabidopsis thaliana GN=ERF113 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 6.066e-14
Identity = 33/47 (70.21%), Postives = 39/47 (82.98%), Query Frame = 3
Query:  336 DEKKPKRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEE 476
            D+ +P+R+    YRG+RQRPWGKWAAEIRDP+K  RVWLGTF TAEE
Sbjct:   30 DQDQPRRRH---YRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEE 73          
BLAST of CX296277 vs. ExPASy Swiss-Prot
Match: EF109_ARATH (Ethylene-responsive transcription factor ERF109 OS=Arabidopsis thaliana GN=ERF109 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.765e-13
Identity = 36/89 (40.45%), Postives = 55/89 (61.80%), Query Frame = 3
Query:  210 FAATKQLPHNFESTPFSDEHQSLAKIKRPQPPSYLNSCSASGDEKKPKRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEE 476
            FA  +++  N +      E +  +   R +  S +   +  G + + ++ +KN YRG+RQRPWGK+AAEIRDP++  RVWLGTF TAE+
Sbjct:   87 FAPNQRIEKNHQQ-----EEEITSSSNRRRESSPVAKKAEGGGKIRKRKNKKNGYRGVRQRPWGKFAAEIRDPKRATRVWLGTFETAED 170          
BLAST of CX296277 vs. ExPASy Swiss-Prot
Match: RAP26_ARATH (Ethylene-responsive transcription factor RAP2-6 OS=Arabidopsis thaliana GN=RAP2-6 PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 2.305e-13
Identity = 36/64 (56.25%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  294 PQP----PSYLNSCSASGDEKKPKRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAE 473
            PQP     +    C +S   ++PK+     YRG+RQRPWGKWAAEIRDP K  RVWLGTF TAE
Sbjct:   36 PQPLITGSAVTKECESSMSLERPKK-----YRGVRQRPWGKWAAEIRDPHKATRVWLGTFETAE 94          
The following BLAST results are available for this feature:
BLAST of CX296277 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
RAP23_ARATH3.548e-2245.16Ethylene-responsive transcription factor RAP2-3 OS... [more]
RAP22_ARATH9.661e-2038.89Ethylene-responsive transcription factor RAP2-2 OS... [more]
ERF71_ARATH2.811e-1946.61Ethylene-responsive transcription factor ERF071 OS... [more]
RA212_ARATH4.795e-1938.36Ethylene-responsive transcription factor RAP2-12 O... [more]
ERF1_ORYSJ6.924e-1862.86Ethylene-responsive transcription factor 1 OS=Oryz... [more]
EF112_ARATH1.222e-1450.68Ethylene-responsive transcription factor ERF112 OS... [more]
ERF73_ARATH2.723e-1468.75Ethylene-responsive transcription factor ERF073 OS... [more]
EF113_ARATH6.066e-1470.21Ethylene-responsive transcription factor ERF113 OS... [more]
EF109_ARATH1.765e-1340.45Ethylene-responsive transcription factor ERF109 OS... [more]
RAP26_ARATH2.305e-1356.25Ethylene-responsive transcription factor RAP2-6 OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05138C05SK FerrChloL1 Citrus clementina cDNA clone C05138C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296277 ID=CX296277|Name=CX296277|organism=Citrus clementina|type=EST|length=478bp
ACGAGGGTAAACCCTTTGAGTTCTCTCGCATCTTCTTTTCTCTTATAATC
GCCAAAACCACAGCCTGACCTGATCGCTAGTTTAGTTTCAGTGCTTTATT
ATTACATTTACTTGCGGAAAGAATGTGTGGCGGTTCTATCTTAGGAGACT
TCTTTCCTCGCCACGGCGGCAGCCGCGTCACCGCTTCCGACCTCTGGCCC
AACTCACCCTTCGCTGCTACTAAACAACTCCCTCACAACTTTGAATCTAC
TCCGTTCTCCGATGAACACCAGTCACTGGCCAAAATCAAACGCCCTCAAC
CCCCTTCATATCTAAACTCCTGTTCAGCTTCAGGTGATGAGAAAAAGCCC
AAGAGGCAGAGGAAGAATCTCTACAGGGGAATAAGGCAACGCCCCTGGGG
CAAATGGGCAGCTGAGATTCGTGACCCAAGGAAAGGAGTTCGAGTCTGGC
TCGGCACATTCAACACTGCCGAAGAAGC
back to top