CX296280

Overview
NameCX296280
Unique NameCX296280
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX296280_ssr125 microsatellite CX296280_ssr125:125..136. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig2329 contig Ccv1_Contig2329:27..723. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296280 vs. ExPASy Swiss-Prot
Match: 1A1D_RALEH (1-aminocyclopropane-1-carboxylate deaminase OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acdS PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.082e-18
Identity = 53/132 (40.15%), Postives = 76/132 (57.58%), Query Frame = 3
Query:  243 HLTPIPSHVFSLGHFPTPIHKWNL--PNLPHNTEVWLKRDDL-SGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLVDQDPGLTGNLLVERLVGAHIELISK 629
            +L   P H  + G  PTPIH  +    +L    E++ KRDD  SG+   GNK RKLE+++ D +AQGAD +++IGGIQSNH R  A  A +L L C L+        D      GN+ + R++GA + L+S+
Sbjct:    2 NLKQFPRHSLTFG--PTPIHPLSRLSESLGGKVELYAKRDDCNSGLAFGGNKTRKLEYVIPDVLAQGADTLVSIGGIQSNHTRQVAAIAAHLGLKCVLVQENWVNYSDAVYDRVGNIQMSRIMGADVRLVSE 131          
BLAST of CX296280 vs. ExPASy Swiss-Prot
Match: 1A1D_THEMA (Putative 1-aminocyclopropane-1-carboxylate deaminase OS=Thermotoga maritima GN=TM_0225 PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.666e-17
Identity = 48/123 (39.02%), Postives = 74/123 (60.16%), Query Frame = 3
Query:  288 PTPIHKWNLPNLPHNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLVDQDPGLTGNLLVERLVGAHIELISKEEYSKIGSV 656
            PTP+      +  +   +++KRDDL+ +  SGNK+RKLE+L+ +A+ +GA  + T GG+QSNH RA A  ++   L   L LR  + +      L GNLL++ L+GA I  +S EEY +I  +
Sbjct:    9 PTPVQFLKRLSEKYGFNIYVKRDDLTELVGSGNKIRKLEYLLWEALKKGATTVFTCGGLQSNHARATAYVSRRYGLKPVLFLRKGEKV------LNGNLLLDILLGAEIVEVSPEEYERIDEI 125          
BLAST of CX296280 vs. ExPASy Swiss-Prot
Match: 1A1D_PYRHO (Putative 1-aminocyclopropane-1-carboxylate deaminase OS=Pyrococcus horikoshii GN=PH0054 PE=1 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 3.481e-17
Identity = 46/107 (42.99%), Postives = 70/107 (65.42%), Query Frame = 3
Query:  291 TPIHKWNLPNLPHN--TEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLVDQDPGLTGNLLVERLVG 605
            TPI    LPN+      +V++KRDDL+G+ + GNK+RKLE+L+ DA+++GAD +IT+G + SNH     +AAK L LD  L+LR  +        L GN L+++++G
Sbjct:   22 TPIQY--LPNISREIGADVYIKRDDLTGLGIGGNKIRKLEYLLGDALSKGADVVITVGAVHSNHAFVTGLAAKKLGLDAILVLRGKE-------ELKGNYLLDKIMG 119          
BLAST of CX296280 vs. ExPASy Swiss-Prot
Match: 1A1D_PYRAB (Putative 1-aminocyclopropane-1-carboxylate deaminase OS=Pyrococcus abyssi GN=PYRAB00630 PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.547e-17
Identity = 44/90 (48.89%), Postives = 63/90 (70.00%), Query Frame = 3
Query:  336 EVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLVDQDPGLTGNLLVERLVG 605
            +V++KRDDL+G+ + GNK+RKLEFL+ DA+++G D +ITIG + SNH    A+AAK L L   LILR  +V       L GN L+++L+G
Sbjct:   37 DVYVKRDDLTGLGIGGNKIRKLEFLLGDALSRGCDTVITIGAVHSNHAFVTALAAKKLGLGAVLILRGEEV-------LKGNYLLDKLMG 119          
BLAST of CX296280 vs. ExPASy Swiss-Prot
Match: DCYD_SERP5 (D-cysteine desulfhydrase OS=Serratia proteamaculans (strain 568) GN=dcyD PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 6.566e-16
Identity = 45/110 (40.91%), Postives = 65/110 (59.09%), Query Frame = 3
Query:  291 TPIHKWNLPNLPHNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLVDQDPGLTGNLLVERLVGAHIEL 620
            TP+ K +  +     E+++KRDD++ M + GNK+RKLEFL ADA+ QGAD ++T G IQSNH R  A  A  L L C  +L       +++    GN L+  L  A +E+
Sbjct:   20 TPLEKLSRLSDYLGREIYIKRDDVTPMAMGGNKLRKLEFLAADALRQGADTLVTAGAIQSNHVRQTAAVAAKLGLHCVALLENPIDTQEENYLTNGNRLLLGLFNAQVEM 129          
BLAST of CX296280 vs. ExPASy Swiss-Prot
Match: 1A1D_BURCC (1-aminocyclopropane-1-carboxylate deaminase OS=Burkholderia cenocepacia (strain MC0-3) GN=acdS PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 6.566e-16
Identity = 50/131 (38.17%), Postives = 74/131 (56.49%), Query Frame = 3
Query:  243 HLTPIPSHVFSLGHFPTPIH--KWNLPNLPHNTEVWLKRDDL-SGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLVDQDPGLTGNLLVERLVGAHIELIS 626
            +L   P +  + G  PTPI   K    +L    E++ KR+D  SG+   GNK RKLE+L+ DA+AQGAD +++IGG+QSN  R  A  A +L + C L+        D      GN+ + R++GA + L+S
Sbjct:    2 NLQRFPRYPLTFG--PTPIQPLKRLSAHLGGKVELYAKREDCNSGLAFGGNKTRKLEYLVPDALAQGADTLVSIGGVQSNQTRQVAAVAAHLGMKCVLVQEHWVNYEDPVYDRVGNIQLSRMMGADVRLVS 130          
BLAST of CX296280 vs. ExPASy Swiss-Prot
Match: 1A1D_BRAJA (1-aminocyclopropane-1-carboxylate deaminase OS=Bradyrhizobium japonicum GN=acdS PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 6.566e-16
Identity = 44/115 (38.26%), Postives = 68/115 (59.13%), Query Frame = 3
Query:  288 PTPIHKWNL--PNLPHNTEVWLKRDDL-SGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLVDQDPGLTGNLLVERLVGAHIELI 623
            PTPI K      +L  N E++ KR+D  SG+   GNK+RKLE+++ DA+A  AD +++IGG+QSNH R  A  A  + + C L+        D      GN+++ R++GA + L+
Sbjct:   14 PTPIEKLERLSKHLGGNVEIYAKREDCNSGLAYGGNKLRKLEYIIPDAIASNADTLVSIGGVQSNHTRMIAAVAAKIGMKCRLVQEAWVPHEDAVYDRVGNIMLSRIMGADVRLV 128          
BLAST of CX296280 vs. ExPASy Swiss-Prot
Match: 1A1D_BURTA (1-aminocyclopropane-1-carboxylate deaminase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acdS PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 8.575e-16
Identity = 50/130 (38.46%), Postives = 72/130 (55.38%), Query Frame = 3
Query:  243 HLTPIPSHVFSLGHFPTPIH--KWNLPNLPHNTEVWLKRDDL-SGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLVDQDPGLTGNLLVERLVGAHIELI 623
            +L   P +  + G  PTPI   K    +L    E++ KRDD  SG+   GNK RKLE+L+ DA+AQG D +++IGGIQSN  R  A  A +L + C L+        D      GN+ + R++GA + L+
Sbjct:    2 NLQKFPRYPLTFG--PTPIQPLKRLSAHLGGKVELYAKRDDCNSGLAFGGNKTRKLEYLIPDALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYHDAVYDRVGNIQMSRMMGADVRLV 129          
BLAST of CX296280 vs. ExPASy Swiss-Prot
Match: 1A1D_BURP1 (1-aminocyclopropane-1-carboxylate deaminase OS=Burkholderia pseudomallei (strain 1710b) GN=acdS PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 8.575e-16
Identity = 50/130 (38.46%), Postives = 72/130 (55.38%), Query Frame = 3
Query:  243 HLTPIPSHVFSLGHFPTPIH--KWNLPNLPHNTEVWLKRDDL-SGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLVDQDPGLTGNLLVERLVGAHIELI 623
            +L   P +  + G  PTPI   K    +L    E++ KRDD  SG+   GNK RKLE+L+ DA+AQG D +++IGGIQSN  R  A  A +L + C L+        D      GN+ + R++GA + L+
Sbjct:    2 NLQKFPRYPLTFG--PTPIQPLKRLSAHLGGKVELYAKRDDCNSGLAFGGNKTRKLEYLIPDALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYHDAVYDRVGNIQMSRMMGADVRLV 129          
BLAST of CX296280 vs. ExPASy Swiss-Prot
Match: DCYD_SALTY (D-cysteine desulfhydrase OS=Salmonella typhimurium GN=dcyD PE=3 SV=3)

HSP 1 Score: 83.1889 bits (204), Expect = 1.463e-15
Identity = 53/128 (41.41%), Postives = 72/128 (56.25%), Query Frame = 3
Query:  243 HLTPIPSHVFSLGHFPTPIHKWNLPNLPH--NTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLVDQDPGLTGNLLVERLVGAHIEL 620
            HLT  P   F +G  PTP+    LP L      E+++KRDD++ + + GNK+RKLEFL+ADA+ +GAD +IT G IQSNH R  A  A  L L C  +L        ++    GN L+  L    IE+
Sbjct:    5 HLTRFPRLEF-IGA-PTPLEY--LPRLSDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEM 128          
The following BLAST results are available for this feature:
BLAST of CX296280 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 97
Match NameE-valueIdentityDescription
1A1D_RALEH1.082e-1840.151-aminocyclopropane-1-carboxylate deaminase OS=Ral... [more]
1A1D_THEMA2.666e-1739.02Putative 1-aminocyclopropane-1-carboxylate deamina... [more]
1A1D_PYRHO3.481e-1742.99Putative 1-aminocyclopropane-1-carboxylate deamina... [more]
1A1D_PYRAB4.547e-1748.89Putative 1-aminocyclopropane-1-carboxylate deamina... [more]
DCYD_SERP56.566e-1640.91D-cysteine desulfhydrase OS=Serratia proteamaculan... [more]
1A1D_BURCC6.566e-1638.171-aminocyclopropane-1-carboxylate deaminase OS=Bur... [more]
1A1D_BRAJA6.566e-1638.261-aminocyclopropane-1-carboxylate deaminase OS=Bra... [more]
1A1D_BURTA8.575e-1638.461-aminocyclopropane-1-carboxylate deaminase OS=Bur... [more]
1A1D_BURP18.575e-1638.461-aminocyclopropane-1-carboxylate deaminase OS=Bur... [more]
DCYD_SALTY1.463e-1541.41D-cysteine desulfhydrase OS=Salmonella typhimurium... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05138C08SK FerrChloL1 Citrus clementina cDNA clone C05138C08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296280 ID=CX296280|Name=CX296280|organism=Citrus clementina|type=EST|length=696bp
AGAGGCCTCGTGCCGAATTCCTCGTGCCGAATTCGGCACGAGGCAGCTGC
AGCGGTAACCTTCTGAGTTCAATTGTTTCTCCAAAATTAAGACAACGCCT
AATCAGAGTCTCTGAGTCTCAGCTTCATCATCATCAGCAGCATAAAATCA
AAATGGAAAGAAAAGAGAGCGGTAATGATAGTGATGCTTTCGGTTTCAAA
TTCCTCACCAAAACCCCATACGCTTCTCCTTCTTGGGCTTCTCATCTCAC
CCCCATCCCTTCTCACGTCTTCTCTCTCGGCCACTTTCCAACTCCAATTC
ACAAATGGAACCTCCCTAATTTGCCCCATAACACTGAGGTCTGGCTCAAG
CGTGATGACCTTTCCGGCATGCAATTGAGTGGAAACAAGGTAAGGAAATT
AGAGTTTTTGATGGCAGATGCAGTGGCTCAAGGTGCTGATTGCATCATCA
CCATTGGAGGCATCCAAAGCAATCATTGTCGTGCTGCTGCCGTTGCTGCC
AAGTATCTCAATCTTGATTGTTATCTTATTCTTCGCACCTCTAAGGTTCT
GGTGGACCAAGATCCTGGTTTGACTGGCAATCTACTAGTTGAACGTTTAG
TTGGAGCTCATATTGAACTTATCTCTAAAGAAGAGTATTCAAAAATTGGG
AGTGTGACTCTTACTAACATTTTAAAGAAAAGTTGCTAAAGGAAGG
back to top