CX296316

Overview
NameCX296316
Unique NameCX296316
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length711
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12113 contig Ccv1_Contig12113:888..1598. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296316 vs. ExPASy Swiss-Prot
Match: RL4_PRUAR (60S ribosomal protein L4 OS=Prunus armeniaca GN=RPL4 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 3.482e-44
Identity = 97/141 (68.79%), Postives = 104/141 (73.76%), Query Frame = -3
Query:  287 LDEIYGKFDKGSEKKKGYVLPRSKMVNADLARIINSDEVQSVVRPIKTEVKRAXXXXXXXXXXXXXXXXXPYAKTARRMSLLAEAQRVXXXXXXXXXXXKPITKEEAAAIKSAGKAWYQTMISDSDYTEFENFSKWLGVSQ 709
            LD IYG FDK SEKK GYVLPRSKMVNADLARIINSDEVQSVV PI+   KRA                 PYAKTARRMSLLAEA+RV           KPI+KEEA+ IK+AGKAWYQTMISDSDYTEF+NF+KWLGVSQ
Sbjct:  268 LDSIYGSFDKVSEKKNGYVLPRSKMVNADLARIINSDEVQSVVSPIQEGSKRAPLKKNPLRILNTMLKLNPYAKTARRMSLLAEAERVKAKKEKLDKKRKPISKEEASTIKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 408          
BLAST of CX296316 vs. ExPASy Swiss-Prot
Match: RL4A_ARATH (60S ribosomal protein L4-1 OS=Arabidopsis thaliana GN=RPL4A PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 3.850e-43
Identity = 92/141 (65.25%), Postives = 104/141 (73.76%), Query Frame = -3
Query:  287 LDEIYGKFDKGSEKKKGYVLPRSKMVNADLARIINSDEVQSVVRPIKTEVKRAXXXXXXXXXXXXXXXXXPYAKTARRMSLLAEAQRVXXXXXXXXXXXKPITKEEAAAIKSAGKAWYQTMISDSDYTEFENFSKWLGVSQ 709
            L+ IYG F+K SEKKKGYVLPR+KMVNADLARIINSDE+QSVV PIK + KRA                 PYAKTA+RMSLLAEAQRV           K +TKEEA AIK+AGK+WY+TMISDSDYTEF+NF+KWLG SQ
Sbjct:  266 LESIYGSFEKPSEKKKGYVLPRAKMVNADLARIINSDEIQSVVNPIKKDAKRAVLKKNPLKNLNVMLKLNPYAKTAKRMSLLAEAQRVKAKKEKLAKKRKTVTKEEALAIKAAGKSWYKTMISDSDYTEFDNFTKWLGASQ 406          
BLAST of CX296316 vs. ExPASy Swiss-Prot
Match: RL4B_ARATH (60S ribosomal protein L4-2 OS=Arabidopsis thaliana GN=RPL4D PE=1 SV=2)

HSP 1 Score: 173.326 bits (438), Expect = 1.120e-42
Identity = 94/141 (66.67%), Postives = 102/141 (72.34%), Query Frame = -3
Query:  287 LDEIYGKFDKGSEKKKGYVLPRSKMVNADLARIINSDEVQSVVRPIKTEVKRAXXXXXXXXXXXXXXXXXPYAKTARRMSLLAEAQRVXXXXXXXXXXXKPITKEEAAAIKSAGKAWYQTMISDSDYTEFENFSKWLGVSQ 709
            L+ IYG F+K SEKKKGYVLPR+KMVNADLARIINSDEVQSVV PIK   KRA                 PYAKTA+RMSLLAEA RV           K +TKEEA AIK+AGKAWYQTMISDSDYTEF+NF+KWLG SQ
Sbjct:  267 LESIYGSFEKPSEKKKGYVLPRAKMVNADLARIINSDEVQSVVNPIKDGSKRAVLKKNPLKNLNVMFKLNPYAKTAKRMSLLAEASRVKAKKEKLEKKRKVVTKEEAQAIKAAGKAWYQTMISDSDYTEFDNFTKWLGASQ 407          
The following BLAST results are available for this feature:
BLAST of CX296316 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
RL4_PRUAR3.482e-4468.7960S ribosomal protein L4 OS=Prunus armeniaca GN=RP... [more]
RL4A_ARATH3.850e-4365.2560S ribosomal protein L4-1 OS=Arabidopsis thaliana... [more]
RL4B_ARATH1.120e-4266.6760S ribosomal protein L4-2 OS=Arabidopsis thaliana... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05138G03SK FerrChloL1 Citrus clementina cDNA clone C05138G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296316 ID=CX296316|Name=CX296316|organism=Citrus clementina|type=EST|length=711bp
ACGAGGCAGCATTATAATTTTTAAGTATAAATAGTACCATTAAGACAATA
AATCCACCTCCTAAAACATATAACTCCAATTCTAACTTCAAAGAAAGTTC
TTTCACCTTGCCCATAAAGACAAAAACGCTGGGAGGAAAAACATTGACCA
TTCAGCTTATCTTCCTTCCAAACATTCTCATCCATGACTCAAAACAGCAA
AAGATACTAAAATTCAACAGCAAATCCACAAAGATTAACAAGATATTGTC
TCAAAAATCAAAATTTAAAAACCAACAATCAGATTACTGAGAAACACCAA
GCCACTTCGAGAAGTTCTCGAACTCGGTATAATCACTGTCTGAGATCATA
GTCTGGTACCATGCCTTGCCGGCAGACTTGATTGCAGCTGCCTCCTCCTT
AGTGATGGGCTTCCTCTTCTTGTCGAGCTTCTCCTTCTTAGCTTTAACCC
GTTGTGCCTCAGCCAAAAGTGACATCCGTCGAGCAGTCTTAGCATATGGG
TTCAACCTCAACAGAGTATTCAAGTTCTTGAGAGGATTCTTCTTCATCGG
AGCCCTCTTAACCTCCGTCTTAATCGGCCTGACAACAGACTGCACCTCAT
CCGAGTTAATAATCCTAGCCAAGTCAGCGTTGACCATCTTGGAACGAGGC
AGCACATAACCCTTCTTCTTCTCGGAACCCTTATCAAACTTACCATAAAT
CTCATCAAGCT
back to top