CX296320

Overview
NameCX296320
Unique NameCX296320
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length411
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14140 contig Ccv1_Contig14140:1249..1659. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296320 vs. ExPASy Swiss-Prot
Match: GP107_MOUSE (Protein GPR107 OS=Mus musculus GN=Gpr107 PE=2 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 2.180e-26
Identity = 48/90 (53.33%), Postives = 69/90 (76.67%), Query Frame = 3
Query:   45 FPIVWSIKNLREAARTDGKAAVNLMKLTLFRQYYIVVICYIYFTRVVVYALETITSYKYLWTSVVAGELATLAFYVFTGYKFKPEAHNPY 314
            FP+VWSI++L+EA+ TDGKAA+NL KL LFR YY++++CYIYFTR++ + L+    +++ W   +  E ATL F+V TGYKF+P + NPY
Sbjct:  416 FPVVWSIRHLQEASATDGKAAINLAKLRLFRHYYVLIVCYIYFTRIIAFLLKFAVPFQWKWLYQLLDETATLVFFVLTGYKFRPASDNPY 505          
BLAST of CX296320 vs. ExPASy Swiss-Prot
Match: GP108_HUMAN (Protein GPR108 OS=Homo sapiens GN=GPR108 PE=2 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 4.112e-25
Identity = 48/90 (53.33%), Postives = 68/90 (75.56%), Query Frame = 3
Query:   45 FPIVWSIKNLREAARTDGKAAVNLMKLTLFRQYYIVVICYIYFTRVVVYALETITSYKYLWTSVVAGELATLAFYVFTGYKFKPEAHNPY 314
            FP+VWSI++L++A+ TDGK AVNL KL LFR YY++VICY+YFTR++   L+    +++ W   +  E +TLAF+V TGYKF+P  +NPY
Sbjct:  415 FPVVWSIRHLQDASGTDGKVAVNLAKLKLFRHYYVMVICYVYFTRIIAILLQVAVPFQWQWLYQLLVEGSTLAFFVLTGYKFQPTGNNPY 504          
BLAST of CX296320 vs. ExPASy Swiss-Prot
Match: GP108_BOVIN (Protein GPR108 OS=Bos taurus GN=GPR108 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.112e-25
Identity = 49/90 (54.44%), Postives = 67/90 (74.44%), Query Frame = 3
Query:   45 FPIVWSIKNLREAARTDGKAAVNLMKLTLFRQYYIVVICYIYFTRVVVYALETITSYKYLWTSVVAGELATLAFYVFTGYKFKPEAHNPY 314
            FP+VWSI++L++A+ TDGK AVNL KL LFR YY++VICYIYFTR++   L  +  +++ W   +  E +TLAF+V TGYKF+P   NPY
Sbjct:  420 FPVVWSIRHLQDASGTDGKVAVNLAKLKLFRHYYVMVICYIYFTRIIAILLRAVVPFQWQWLYQLLVEGSTLAFFVLTGYKFQPARDNPY 509          
BLAST of CX296320 vs. ExPASy Swiss-Prot
Match: GP108_MOUSE (Protein GPR108 OS=Mus musculus GN=Gpr108 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 7.013e-25
Identity = 48/90 (53.33%), Postives = 67/90 (74.44%), Query Frame = 3
Query:   45 FPIVWSIKNLREAARTDGKAAVNLMKLTLFRQYYIVVICYIYFTRVVVYALETITSYKYLWTSVVAGELATLAFYVFTGYKFKPEAHNPY 314
            FP+VWSI++L++A+ TDGK AVNL +L LFR YY++VICYIYFTR++   L+    +++ W   +  E +TLAF+V TGYKF+P   NPY
Sbjct:  441 FPVVWSIRHLQDASGTDGKVAVNLARLKLFRHYYVMVICYIYFTRIIAILLQVAVPFQWQWLYQLLVESSTLAFFVLTGYKFQPAGDNPY 530          
BLAST of CX296320 vs. ExPASy Swiss-Prot
Match: GP108_RAT (Protein GPR108 OS=Rattus norvegicus GN=Gpr108 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 1.196e-24
Identity = 48/90 (53.33%), Postives = 66/90 (73.33%), Query Frame = 3
Query:   45 FPIVWSIKNLREAARTDGKAAVNLMKLTLFRQYYIVVICYIYFTRVVVYALETITSYKYLWTSVVAGELATLAFYVFTGYKFKPEAHNPY 314
            FP+VWSI++L++A+ TDGK A+NL KL LFR YY++VICYIYFTR++   L     +++ W   +  E +TLAF+V TGYKF+P   NPY
Sbjct:  448 FPVVWSIRHLQDASGTDGKVAMNLAKLKLFRHYYVMVICYIYFTRIIAILLRVAVPFQWQWLYQLLVESSTLAFFVLTGYKFQPAGDNPY 537          
BLAST of CX296320 vs. ExPASy Swiss-Prot
Match: GP107_HUMAN (Protein GPR107 OS=Homo sapiens GN=GPR107 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.159e-19
Identity = 48/138 (34.78%), Postives = 69/138 (50.00%), Query Frame = 3
Query:   45 FPIVWSIKNLREAARTDGK------------------------------------------------AAVNLMKLTLFRQYYIVVICYIYFTRVVVYALETITSYKYLWTSVVAGELATLAFYVFTGYKFKPEAHNPY 314
            FP+VWSI++L+EA+ TDGK                                                AA+NL KL LFR YY++++CYIYFTR++ + L+    +++ W   +  E ATL F+V TGYKF+P + NPY
Sbjct:  417 FPVVWSIRHLQEASATDGKGDSMGPLQQRANLRAGSRIESHHFAQADLELLASSCPPASVSQRAGITAAINLAKLKLFRHYYVLIVCYIYFTRIIAFLLKLAVPFQWKWLYQLLDETATLVFFVLTGYKFRPASDNPY 554          
The following BLAST results are available for this feature:
BLAST of CX296320 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
GP107_MOUSE2.180e-2653.33Protein GPR107 OS=Mus musculus GN=Gpr107 PE=2 SV=2[more]
GP108_HUMAN4.112e-2553.33Protein GPR108 OS=Homo sapiens GN=GPR108 PE=2 SV=2[more]
GP108_BOVIN4.112e-2554.44Protein GPR108 OS=Bos taurus GN=GPR108 PE=2 SV=1[more]
GP108_MOUSE7.013e-2553.33Protein GPR108 OS=Mus musculus GN=Gpr108 PE=2 SV=1[more]
GP108_RAT1.196e-2453.33Protein GPR108 OS=Rattus norvegicus GN=Gpr108 PE=2... [more]
GP107_HUMAN1.159e-1934.78Protein GPR107 OS=Homo sapiens GN=GPR107 PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionC05138G10SK FerrChloL1 Citrus clementina cDNA clone C05138G10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296320 ID=CX296320|Name=CX296320|organism=Citrus clementina|type=EST|length=411bp
ACGAGGTCTTGCTTGTGGATGTTGTGTGTTGCTGTGCCGTTTTGTTCCCC
ATCGTTTGGTCGATCAAGAACCTGCGTGAGGCTGCCAGGACTGACGGCAA
AGCCGCGGTTAATTTGATGAAGCTCACACTGTTCAGACAGTACTATATTG
TGGTTATCTGCTACATTTACTTTACTCGGGTGGTGGTCTATGCACTTGAG
ACTATTACTTCCTACAAGTATCTGTGGACAAGCGTGGTGGCTGGAGAATT
GGCCACGCTGGCATTTTATGTGTTCACCGGTTACAAGTTTAAGCCCGAGG
CACATAATCCGTACTTTGTGATTGATGATGAGGAGGAAGAGGCTGCTGCT
GAGGCATTGAAGCTTGAAGAGGAGTTTGAATTGTGATTGACACCATCCAA
ATGGGAGAGTA
back to top