CX296326

Overview
NameCX296326
Unique NameCX296326
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length273
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX296326_ssr185 microsatellite CX296326_ssr185:185..196. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CX296326 vs. ExPASy Swiss-Prot
Match: CSLE1_ARATH (Cellulose synthase-like protein E1 OS=Arabidopsis thaliana GN=CSLE1 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.945e-15
Identity = 39/70 (55.71%), Postives = 51/70 (72.86%), Query Frame = 3
Query:    6 AVQKVIVGDGYVKFYETMLLQILLCSALVLINWPLYQGLFLRKDNGKMPSSVTTKSLVLALSVCTCFTFL 215
            AV +++ GDG     +TM +Q ++   LV+INWPLY+G+ LR+D GKMP SVT KS+VLALS CTC  FL
Sbjct:  662 AVARLVSGDG--GDLKTMGMQFVITGVLVVINWPLYKGMLLRQDKGKMPMSVTVKSVVLALSACTCLAFL 729          
The following BLAST results are available for this feature:
BLAST of CX296326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
CSLE1_ARATH2.945e-1555.71Cellulose synthase-like protein E1 OS=Arabidopsis ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05138H07SK FerrChloL1 Citrus clementina cDNA clone C05138H07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296326 ID=CX296326|Name=CX296326|organism=Citrus clementina|type=EST|length=273bp
ACGAGGCGGTACAGAAGGTGATTGTAGGTGATGGCTATGTTAAATTCTAC
GAGACGATGCTCTTGCAAATCCTTTTATGCAGCGCCTTAGTTCTCATCAA
CTGGCCTCTGTATCAAGGCCTTTTCTTGAGGAAGGACAACGGCAAGATGC
CAAGCTCTGTGACCACTAAATCGCTTGTATTAGCTCTGTCTGTCTGTACT
TGTTTTACCTTCTTGTATTAAATTCTCTTTTCAAAAAAAACCTCGTGCCG
AATTCGGCGAGGGGGGGCCCGGT
back to top