CX296329

Overview
NameCX296329
Unique NameCX296329
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length695
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12635 contig Ccv1_Contig12635:43..737. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296329 vs. ExPASy Swiss-Prot
Match: HS235_ARATH (23.5 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP23.5 PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 6.301e-43
Identity = 107/214 (50.00%), Postives = 134/214 (62.62%), Query Frame = 2
Query:   35 ASSLALKRLVSFNLI--PRALRCTVAPSATSASRFFNTNAVRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRSLSQVLNFMDQMTESPFFSGTRG----GLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXXSV--RRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFPVKVD 652
            +S+LAL+RL+S + +  PRALR  V P A S SR FNTNA R Y                                    TRSLSQ+LNFMDQ++E P  S TRG    G+RRGW+ KE DDAL+L IDMPGL +EDV+++LEQNTLVIR           S   RR+TSRI+LPEK+Y+TD+IKAEMKNGVLKV +PK+KE+ER ++  + VD
Sbjct:    4 SSALALRRLLSSSTVAVPRALRA-VRPVAAS-SRLFNTNAARNYEDGVDRNHHSNRHVSRHGGDFFSHILDPFTP-----TRSLSQMLNFMDQVSEIPLVSATRGMGASGVRRGWNVKEKDDALHLRIDMPGLSREDVKLALEQNTLVIRGEGETEEGEDVSGDGRRFTSRIELPEKVYKTDEIKAEMKNGVLKVVIPKIKEDERNNIRHINVD 210          
BLAST of CX296329 vs. ExPASy Swiss-Prot
Match: HS22M_PEA (Heat shock 22 kDa protein, mitochondrial OS=Pisum sativum GN=HSP22 PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.127e-42
Identity = 106/209 (50.72%), Postives = 128/209 (61.24%), Query Frame = 2
Query:   32 MASSLALKRLVSFNLIPRALRCTVAPSATSASRFFNTNAVRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRSLSQVLNFMDQMTESPFFSGTRGGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXX--SVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFPVKVD 652
            MASSLALKR +S  L+  +    + P A+SASR FNTNA+RQY                                     RSLSQVLN +D +T++P  S      RRGWDA+ET+DAL L +DMPGLGKEDV++S+EQNTL I+             S RR++SRIDLPEKLY+ D IKAEMKNGVLKVTVPK+KEEER +V  VKVD
Sbjct:    1 MASSLALKRFLSSGLLSSSF---LRPVASSASRSFNTNAMRQYDQHSDDRNVDVYRHSFPRTRRDDLLLSDVFDPFSPP-RSLSQVLNMVDLLTDNPVLSAAS---RRGWDARETEDALFLRLDMPGLGKEDVKISVEQNTLTIKGEEGAKESEEKEKSGRRFSSRIDLPEKLYKIDVIKAEMKNGVLKVTVPKMKEEERNNVINVKVD 202          
BLAST of CX296329 vs. ExPASy Swiss-Prot
Match: HS23M_ARATH (23.6 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP23.6 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 5.897e-41
Identity = 102/215 (47.44%), Postives = 129/215 (60.00%), Query Frame = 2
Query:   32 MASSLALKRLVSFNLIPRALRCTVAPSATSASRFFNTNAVRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRSLSQVLNFMDQMTESPFFSGTRG----GLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXXSV----RRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFPVKVD 652
            MAS+LALKRL+S ++ PR+ R  + P+ +S  R FNTNAVR Y                                    TRS+SQVLN MDQ  E+P  S TRG    G RRGWD KE DDAL L IDMPGL +EDV+++LEQ+TLVIR                 RR+TSRI LP+K+Y+ D+IKAEMKNGVLKV +PK+KE+ER DV  ++++
Sbjct:    1 MASALALKRLLSSSIAPRS-RSVLRPAVSS--RLFNTNAVRSYDDDGENGDGVDLYRRSVPRRRGDFFSDVFDPFSP--TRSVSQVLNLMDQFMENPLLSATRGMGASGARRGWDIKEKDDALYLRIDMPGLSREDVKLALEQDTLVIRGEGKNEEDGGEEGESGNRRFTSRIGLPDKIYKIDEIKAEMKNGVLKVVIPKMKEQERNDVRQIEIN 210          
BLAST of CX296329 vs. ExPASy Swiss-Prot
Match: HS22M_SOYBN (Heat shock 22 kDa protein, mitochondrial OS=Glycine max GN=HSP23.9 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 6.161e-40
Identity = 67/100 (67.00%), Postives = 81/100 (81.00%), Query Frame = 2
Query:  353 RGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXXSVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFPVKVD 652
            RGWDA+ET+DAL+L +DMPGL KEDV++S+EQNTL+I+           S RRYTSRIDLP+KLY+ DQI+AEMKNGVLKV VPK+KEEER DV  VKV+
Sbjct:  112 RGWDARETEDALHLRVDMPGLAKEDVKISVEQNTLIIKGEGAKEGDEEESARRYTSRIDLPDKLYKIDQIRAEMKNGVLKVVVPKMKEEERKDVISVKVE 211          

HSP 2 Score: 39.6614 bits (91), Expect = 6.161e-40
Identity = 21/43 (48.84%), Postives = 32/43 (74.42%), Query Frame = 2
Query:   32 MASSLALKRLVSFNLIPRALRCTVAPSATSASRFFNTNAVRQY 160
            MASSL  KR +S +L+ R+L   + P+A+++ R F+TNA+RQY
Sbjct:    1 MASSLIAKRFLSSSLLSRSL---LRPAASASHRSFDTNAMRQY 40          

HSP 3 Score: 25.7942 bits (55), Expect = 6.161e-40
Identity = 12/24 (50.00%), Postives = 15/24 (62.50%), Query Frame = 1
Query:  247 CV*SIFTNKEPEPGPELHGSDDGE 318
            CV SIF++ E EPG E  G   G+
Sbjct:   72 CVGSIFSDSEFEPGSEHDGPGHGQ 95          
BLAST of CX296329 vs. ExPASy Swiss-Prot
Match: HS23C_CHERU (Small heat shock protein, chloroplastic OS=Chenopodium rubrum GN=HSP23 PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.029e-37
Identity = 90/208 (43.27%), Postives = 117/208 (56.25%), Query Frame = 2
Query:   38 SSLALKRLVSFNLIPRALRCTVAPSATSASRFFNTNAVRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRSLSQVLNFMDQMTESPFFSGTRGG---LRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXXSVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFPVKVD 652
            +S+AL+RL S NL+   +   +     S SR FNTNA                                        TRS+ Q++N MDQ+ E+PF + +RG    +RRGWD +E ++AL L +DMPGL KEDV+VS+E NTL+I+             RRY+SRI+L   LY+ D IKAEMKNGVLKVTVPK+KEEE+ DVF V VD
Sbjct:    2 ASMALRRLASRNLVSGGIFRPL-----SVSRSFNTNAQMGRVDHDHELDDRSNRAPISRRGDFPASFFSDVFDPFRATRSVGQLMNLMDQLMENPFMAASRGSGRAMRRGWDVREDEEALELKVDMPGLAKEDVKVSVEDNTLIIKSEAEKETEEEEQRRRYSSRIELTPNLYKIDGIKAEMKNGVLKVTVPKIKEEEKKDVFQVMVD 204          
BLAST of CX296329 vs. ExPASy Swiss-Prot
Match: HS24M_ORYSJ (24.1 kDa heat shock protein, mitochondrial OS=Oryza sativa subsp. japonica GN=HSP24.1 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.356e-28
Identity = 86/221 (38.91%), Postives = 117/221 (52.94%), Query Frame = 2
Query:   32 MASSLALKRLVSFNLIPRALRCTVAPSATSA---------SRFFNTNA-VRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT--RSLSQVLNFMDQMTESPFFSGTRGGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXXSVR--RYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFPVKVD 652
            MAS +A KR+  F L+ + L  + A  A SA         SR +NT A +R++                                    +  +SL ++L+ MD +  +P        LRRGW+AKE+++AL+L +DMPGLGKE V+V  EQN+LVI+                RY+ RI+L  ++YR DQIKAEMKNGVLKV VPKVKEE+R DVF V V+
Sbjct:    1 MASIVASKRIPLFRLVEQLLAASPAQGAASALRPVAVAGGSRAYNTGAQLRRHERDESDDDSGRGYDTRRPTRDATMPAFFSDVFRDPFSAPQSLGRLLSLMDDLA-TPAGRAGAATLRRGWNAKESEEALHLRVDMPGLGKEHVKVWAEQNSLVIKGEGEKEAGEDEGAAPARYSGRIELAPEVYRMDQIKAEMKNGVLKVVVPKVKEEQRRDVFQVNVE 220          
BLAST of CX296329 vs. ExPASy Swiss-Prot
Match: HS26M_ORYSJ (26.2 kDa heat shock protein, mitochondrial OS=Oryza sativa subsp. japonica GN=HSP26.2 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.545e-23
Identity = 66/135 (48.89%), Postives = 82/135 (60.74%), Query Frame = 2
Query:  275 SLSQVLNFM-DQMTESPFFSGTRG----GLRRG--WDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXXSVR--RYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFPVKVD 652
            SL ++L  M D    +    GT G      RRG  W AKE DDA++L + MPGLGKE V+V  EQN+LVI+                RYT RI+LP   ++ D+IKAEMKNGVL+V VPK+KEEER DVF V V+
Sbjct:  114 SLGRLLALMEDAAVATAAAPGTNGLATAAARRGGWWVAKEDDDAVHLKVSMPGLGKEHVKVWAEQNSLVIKGEGEKDPEDDADAAPPRYTRRIELPADAFKMDKIKAEMKNGVLRVAVPKLKEEERKDVFQVNVE 248          
BLAST of CX296329 vs. ExPASy Swiss-Prot
Match: HS25P_ARATH (25.3 kDa heat shock protein, chloroplastic OS=Arabidopsis thaliana GN=HSP25.3 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.938e-17
Identity = 52/129 (40.31%), Postives = 74/129 (57.36%), Query Frame = 2
Query:  272 RSLSQVLNFMDQMTES--PFFSGTRGG-----LRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVI----RXXXXXXXXXXXSVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEER 625
            R++ Q+L+ MD+M E   P     RGG     +R  WD KE +  + +  DMPGL KEDV++S+E N LVI    +           SV  Y +R+ LP+   + D+IKAE+KNGVL +T+PK K E +
Sbjct:   93 RTMRQMLDTMDRMFEDTMPVSGRNRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEK-DKIKAELKNGVLFITIPKTKVERK 220          
BLAST of CX296329 vs. ExPASy Swiss-Prot
Match: HS22C_SOYBN (Small heat shock protein, chloroplastic (Fragment) OS=Glycine max GN=HSP22 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.481e-15
Identity = 50/129 (38.76%), Postives = 74/129 (57.36%), Query Frame = 2
Query:  272 RSLSQVLNFMDQMTESPF-FSGTR---GGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVI----RXXXXXXXXXXXSVRRYTS---RIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEER 625
            RS+ Q+L+ MD++ E    F G     G +R  WD K+ +  + +  DMPGL KEDV+VS+E + LVI    +           S R Y+S   R+ LP+   + D++KAE+KNGVL +T+PK K E +
Sbjct:   47 RSMRQILDTMDRVFEDTMTFPGRNIGGGEIRAPWDIKDEEHEIRMRFDMPGLAKEDVKVSVEDDMLVIKGGHKSEQEHGGDDSWSSRTYSSYDTRLKLPDNCEK-DKVKAELKNGVLYITIPKTKVERK 174          
BLAST of CX296329 vs. ExPASy Swiss-Prot
Match: HS22C_PETHY (Small heat shock protein, chloroplastic OS=Petunia hybrida GN=HSP22 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.481e-15
Identity = 45/135 (33.33%), Postives = 79/135 (58.52%), Query Frame = 2
Query:  272 RSLSQVLNFMDQMTESPF-FSGTR----GGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVI-----RXXXXXXXXXXXSVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFPVK 646
            R++ Q+++ MD++ E    F G+R    G +R  WD K+ ++ + +  DMPGL KE+V+VS+E + LVI     +           +   Y +R+ LP+ + + D++KAE+KNGVL +++PK K E++     +K
Sbjct:  108 RTMRQMMDTMDRLFEDTMTFPGSRNRGTGEIRAPWDIKDDENEIKMRFDMPGLSKEEVKVSVEDDVLVIKGEHKKEESGKDDSWGRNYSSYDTRLSLPDNVDK-DKVKAELKNGVLLISIPKTKVEKKVTDVEIK 241          
The following BLAST results are available for this feature:
BLAST of CX296329 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
HS235_ARATH6.301e-4350.0023.5 kDa heat shock protein, mitochondrial OS=Arab... [more]
HS22M_PEA3.127e-4250.72Heat shock 22 kDa protein, mitochondrial OS=Pisum ... [more]
HS23M_ARATH5.897e-4147.4423.6 kDa heat shock protein, mitochondrial OS=Arab... [more]
HS22M_SOYBN6.161e-4067.00Heat shock 22 kDa protein, mitochondrial OS=Glycin... [more]
HS23C_CHERU3.029e-3743.27Small heat shock protein, chloroplastic OS=Chenopo... [more]
HS24M_ORYSJ3.356e-2838.9124.1 kDa heat shock protein, mitochondrial OS=Oryz... [more]
HS26M_ORYSJ5.545e-2348.8926.2 kDa heat shock protein, mitochondrial OS=Oryz... [more]
HS25P_ARATH5.938e-1740.3125.3 kDa heat shock protein, chloroplastic OS=Arab... [more]
HS22C_SOYBN9.481e-1538.76Small heat shock protein, chloroplastic (Fragment)... [more]
HS22C_PETHY9.481e-1533.33Small heat shock protein, chloroplastic OS=Petunia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05138H11SK FerrChloL1 Citrus clementina cDNA clone C05138H11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296329 ID=CX296329|Name=CX296329|organism=Citrus clementina|type=EST|length=695bp
TTGTTTTGTGCTTTCTTTAGAATTCGGCTCAATGGCGTCCTCTCTTGCTC
TCAAGAGGCTTGTTTCTTTTAATCTCATCCCCAGGGCTTTACGCTGCACC
GTCGCTCCTTCTGCTACTTCGGCATCTCGGTTCTTCAACACAAACGCTGT
TCGTCAATACGATGACGGCGGAGACGACCGTGATCTCGACATTGATCGCC
GTTCCGCTCGCTCTTTCCCTCGCCGTCGTGACGACTTCTTCTCAGATGTG
TTTGATCCATTTTCACCAACAAGGAGCCTGAGCCAGGTCCTGAACTTCAT
GGATCAGATGACGGAGAGCCCTTTCTTCAGTGGCACGCGTGGTGGACTGC
GCCGAGGCTGGGATGCCAAAGAAACCGATGACGCATTGAACCTCAGCATC
GACATGCCAGGGCTGGGCAAGGAAGACGTGAGAGTCTCTCTGGAGCAGAA
CACTCTGGTGATCAGAGGCGAGGGCGGAAAAGAAGGAGAGGACGAAGAGA
GCGTGCGTAGGTACACCAGCAGGATTGATTTGCCAGAGAAGCTCTACAGG
ACTGATCAGATCAAGGCTGAGATGAAGAATGGTGTGCTGAAGGTGACGGT
GCCCAAGGTGAAGGAAGAGGAGAGGGCTGATGTGTTCCCAGTGAAGGTTG
ATTAAAGAGTTGGCTTTTAGTAGTAGCTTTTCTGTCCAGGATATT
back to top