CX296331

Overview
NameCX296331
Unique NameCX296331
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length562
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX296331_ssr109 microsatellite CX296331_ssr109:109..118. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig828 contig Ccv1_Contig828:265..826. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296331 vs. ExPASy Swiss-Prot
Match: SR54C_ARATH (Signal recognition particle 54 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=FFC PE=1 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 4.400e-37
Identity = 79/123 (64.23%), Postives = 95/123 (77.24%), Query Frame = -3
Query:  192 AEKSLTIMEAMIEAMTLEEREKPELLAESPSRRKRVAQDSGKADQLVSQLVAQLFQMRVRMKNLMGVMEGGSLPALSNLEDALKSEQXXXXXXXXXXXXXXXXRQFVDPASTRPSPCGFGGGS 560
            AEK+L +MEAMIE MT EERE+PELLAESP RRKR+A+DSGK +Q VS LVAQ+FQMRV+MKNLMGVMEGGS+PALS LEDALK+EQ                ++FV+ AS++P P GFG G+
Sbjct:  442 AEKNLLVMEAMIEVMTPEERERPELLAESPERRKRIAKDSGKTEQQVSALVAQIFQMRVKMKNLMGVMEGGSIPALSGLEDALKAEQKAPPGTARRKRKADSRKKFVESASSKPGPRGFGSGN 564          
BLAST of CX296331 vs. ExPASy Swiss-Prot
Match: SRP54_SYNY3 (Signal recognition particle protein OS=Synechocystis sp. (strain PCC 6803) GN=ffh PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.091e-11
Identity = 37/71 (52.11%), Postives = 50/71 (70.42%), Query Frame = -3
Query:  348 EKSLTIMEAMIEAMTLEEREKPELLAESPSRRKRVAQDSGKADQLVSQLVAQLFQMRVRMKNL-MGVMEGG 557
            EK L   EAMI +MT EER+ P+LLA+SPSRR+R+AQ SG ++  VS+L+    +MR  M+ + MG M GG
Sbjct:  367 EKELKRTEAMISSMTTEERKNPDLLAKSPSRRRRIAQGSGHSETDVSKLITNFTKMRTMMQQMGMGGMPGG 437          
The following BLAST results are available for this feature:
BLAST of CX296331 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
SR54C_ARATH4.400e-3764.23Signal recognition particle 54 kDa protein, chloro... [more]
SRP54_SYNY31.091e-1152.11Signal recognition particle protein OS=Synechocyst... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05139A01SK FerrChloL1 Citrus clementina cDNA clone C05139A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296331 ID=CX296331|Name=CX296331|organism=Citrus clementina|type=EST|length=562bp
CTTAAAAGACACTAGGTGGCAATTCCGTGCTCGGATACATTAATTGATGA
ATTCTTACAGCTCAAACAACGCTTGAAAACTCTTTTAACTTCATGAGTAG
AGATATCTGAGAGAGAGAAAGAATTTACGATTCCTTTACTGTTTGACTGG
AGGACAGCATGTTGGTTGCAGCTGACAAAACTTAAGATCTAGCTCCCACC
CCCAAAACCACAAGGACTTGGCCTTGTTGATGCCGGGTCAACGAACTGCC
TCCTTGATTCTGATCTTCTCTTCCTCCTTGCGGCACCAGGAGGAGCCTTC
TGTTCAGATTTAAGGGCATCCTCAAGATTGCTCAGTGCAGGAAGTGAACC
ACCTTCCATTACACCCATTAAGTTCTTCATACGCACACGCATTTGGAAGA
GTTGAGCAACAAGTTGGCTCACCAGCTGATCTGCTTTCCCAGAATCTTGA
GCAACTCTTTTTCTTCTAGACGGAGATTCAGCCAACAGTTCTGGTTTCTC
CCTTTCCTCAAGCGTCATTGCTTCGATCATTGCTTCCATTATTGTTAAAC
TCTTCTCTGCTT
back to top