CX296383

Overview
NameCX296383
Unique NameCX296383
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX296383 vs. ExPASy Swiss-Prot
Match: ALFC_ORYSJ (Fructose-bisphosphate aldolase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0171300 PE=1 SV=2)

HSP 1 Score: 280.796 bits (717), Expect = 4.658e-75
Identity = 144/188 (76.60%), Postives = 157/188 (83.51%), Query Frame = -2
Query:  141 ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHGIDRTFEVAKKVWAEVFFYLAENNVMFEGILLKPSMVTPGAECKEKATPQQVAEYTLKLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNQGQLTCSARQVHWRG------RIRGGQERNVRQGIHLLNLLAR 686
            ARFAKWRTVVSIPNGPS LAVKEAAWGLARYAAI+QDNGLVPIVEPEILLDG+HGIDRTFEVA+KVWAE FFY+AENNVMFEGILLKPSMVTPGAECK++ATP+QV++YTLKLLHRRIPPAVPGIMFLSGGQSEVEAT NLNAMNQG         + R       +  GGQ  NV+     L L A+
Sbjct:  171 ARFAKWRTVVSIPNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIDRTFEVAQKVWAETFFYMAENNVMFEGILLKPSMVTPGAECKDRATPEQVSDYTLKLLHRRIPPAVPGIMFLSGGQSEVEATQNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGQPENVKAAQDALLLRAK 358          
BLAST of CX296383 vs. ExPASy Swiss-Prot
Match: ALFC2_PEA (Fructose-bisphosphate aldolase 2, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 273.092 bits (697), Expect = 9.713e-73
Identity = 134/146 (91.78%), Postives = 142/146 (97.26%), Query Frame = -2
Query:  249 ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHGIDRTFEVAKKVWAEVFFYLAENNVMFEGILLKPSMVTPGAECKEKATPQQVAEYTLKLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNQ 686
            ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAI+QDNGLVPIVEPEILLDG+HGIDRTFEVA+KVWAEVF+YLAENNV FEGILLKPSMVTPGAE K+KA+P +VAEYTL LLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMN+
Sbjct:  133 ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIDRTFEVAQKVWAEVFYYLAENNVQFEGILLKPSMVTPGAESKDKASPTKVAEYTLNLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNK 278          
BLAST of CX296383 vs. ExPASy Swiss-Prot
Match: ALFC1_PEA (Fructose-bisphosphate aldolase 1, chloroplastic (Fragment) OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 9.713e-73
Identity = 134/146 (91.78%), Postives = 142/146 (97.26%), Query Frame = -2
Query:  249 ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHGIDRTFEVAKKVWAEVFFYLAENNVMFEGILLKPSMVTPGAECKEKATPQQVAEYTLKLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNQ 686
            ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAI+QDNGLVPIVEPEILLDG+HGIDRTFEVA+KVWAEVF+YLAENNV FEGILLKPSMVTPGAE K+KA+P +VAEYTL LLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMN+
Sbjct:  139 ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIDRTFEVAQKVWAEVFYYLAENNVQFEGILLKPSMVTPGAESKDKASPTKVAEYTLNLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNK 284          
BLAST of CX296383 vs. ExPASy Swiss-Prot
Match: ALFC1_ARATH (Probable fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=FBA1 PE=1 SV=2)

HSP 1 Score: 267.314 bits (682), Expect = 5.330e-71
Identity = 136/183 (74.32%), Postives = 153/183 (83.61%), Query Frame = -2
Query:  156 ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHGIDRTFEVAKKVWAEVFFYLAENNVMFEGILLKPSMVTPGAECKEKATPQQVAEYTLKLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNQGQLTCSARQVHWRG------RIRGGQERNVRQGIHLL 686
            ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAI+QD+GLVPIVEPEI+LDG+HGIDRT++VA+KVWAEVFFYLA+NNVMFEGILLKPSMVTPGAE  ++ATP+QVA YTLKLL  RIPPAVPGIMFLSGGQSE+EATLNLNAMNQ          + R       +  GG+E NV+    +L
Sbjct:  182 ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEIMLDGEHGIDRTYDVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAEATDRATPEQVASYTLKLLRNRIPPAVPGIMFLSGGQSELEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGKEENVKAAQDIL 364          
BLAST of CX296383 vs. ExPASy Swiss-Prot
Match: ALFC_SPIOL (Fructose-bisphosphate aldolase, chloroplastic OS=Spinacia oleracea PE=1 SV=3)

HSP 1 Score: 237.269 bits (604), Expect = 5.879e-71
Identity = 119/146 (81.51%), Postives = 127/146 (86.99%), Query Frame = -2
Query:  249 ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHGIDRTFEVAKKVWAEVFFYLAENNVMFEGILLKPSMVTPGAECKEKATPQQVAEYTLKLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNQ 686
            ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAI QDNGL PI+EPEI+LDG+HGIDRTF VA++VWAEVFF LAENNV+ EG  LKPSMV PGA    K  P+QVA+Y LKLLHRR  P VPGIM LSGGQSEVEATLNLNAMNQ
Sbjct:  179 ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAITQDNGLDPILEPEIMLDGEHGIDRTFRVAQQVWAEVFFNLAENNVLLEGSSLKPSMVGPGALSARKGPPEQVADYPLKLLHRRRGPVVPGIMVLSGGQSEVEATLNLNAMNQ 324          

HSP 2 Score: 50.8322 bits (120), Expect = 5.879e-71
Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = -3
Query:  170 KANSLAQLGKYTGEGESEEAKKGMFVK 250
            K+NSLAQLGKYTGEGESEE KK MFVK
Sbjct:  363 KSNSLAQLGKYTGEGESEERKKDMFVK 389          
BLAST of CX296383 vs. ExPASy Swiss-Prot
Match: ALFC2_ARATH (Probable fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=FBA2 PE=1 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 6.961e-71
Identity = 130/146 (89.04%), Postives = 141/146 (96.58%), Query Frame = -2
Query:  249 ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHGIDRTFEVAKKVWAEVFFYLAENNVMFEGILLKPSMVTPGAECKEKATPQQVAEYTLKLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNQ 686
            ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAI+QD+GLVPIVEPEILLDG+H IDRT++VA+KVWAEVFFYLA+NNVMFEGILLKPSMVTPGAE K++ATP+QVA YTLKLL  R+PPAVPGIMFLSGGQSEVEATLNLNAMNQ
Sbjct:  181 ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTYDVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVAAYTLKLLRNRVPPAVPGIMFLSGGQSEVEATLNLNAMNQ 326          
BLAST of CX296383 vs. ExPASy Swiss-Prot
Match: ALFC3_ARATH (Probable fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana GN=FBA3 PE=1 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.605e-67
Identity = 125/146 (85.62%), Postives = 137/146 (93.84%), Query Frame = -2
Query:  249 ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHGIDRTFEVAKKVWAEVFFYLAENNVMFEGILLKPSMVTPGAECKEKATPQQVAEYTLKLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNQ 686
            ARFAKWRTVVS+P GPSALAVKEAAWGLARYAAI+QDNGLVPIVEPEILLDGDH I+RT EVA+KVW+EVFFYLA+NNVMFEGILLKPSMVTPGAE K KA+P+ VA++TL +L RR+PPAVPGIMFLSGGQSE EATLNLNAMNQ
Sbjct:  174 ARFAKWRTVVSVPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAQNNVMFEGILLKPSMVTPGAEHKNKASPETVADFTLTMLKRRVPPAVPGIMFLSGGQSEAEATLNLNAMNQ 319          
BLAST of CX296383 vs. ExPASy Swiss-Prot
Match: ALFC_CHLRE (Fructose-bisphosphate aldolase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ALDCHL PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 8.118e-58
Identity = 105/146 (71.92%), Postives = 124/146 (84.93%), Query Frame = -2
Query:  249 ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHGIDRTFEVAKKVWAEVFFYLAENNVMFEGILLKPSMVTPGAECKEKATPQQVAEYTLKLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNQ 686
            ARFAKWR+VVSIP+GPS + +   A+GLARYAAIAQ+ GLVPIVEPE+LLDG+H IDR  EV + +WAE F Y+A+N VM +GILLKP+MVTPGA+CK KA P +VAEYTLK+L  R PP VPGIMFLSGGQSE+E+TLNLNAMNQ
Sbjct:  158 ARFAKWRSVVSIPHGPSIM-LPRLAYGLARYAAIAQNAGLVPIVEPEVLLDGEHDIDRCLEVQEAIWAETFKYMADNKVMLQGILLKPAMVTPGADCKNKAGPAKVAEYTLKMLAARAPP-VPGIMFLSGGQSELESTLNLNAMNQ 301          

HSP 2 Score: 34.2686 bits (77), Expect = 8.118e-58
Identity = 17/31 (54.84%), Postives = 20/31 (64.52%), Query Frame = -3
Query:  158 KANSLAQLGKYTGEGESEEAKKGMFVKGYTY 250
            KANS AQ GKY    E +EA +GM+ KG  Y
Sbjct:  342 KANSDAQQGKYDATTEGKEAAQGMYEKGKGY 372          
BLAST of CX296383 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 4.702e-43
Identity = 91/147 (61.90%), Postives = 113/147 (76.87%), Query Frame = -2
Query:  249 ARFAKWRTVVSI-PNGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHGIDRTFEVAKKVWAEVFFYLAENNVMFEGILLKPSMVTPGAECKEKATPQQVAEYTLKLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNQ 686
            ARFAKWR V+ I P  PS LA+ E A GLARY  I Q+NGLVPIVEPEIL+DG H IDR  EV+++V A  +  L +++V+ EG  LKP++VTPG+E K K TP+ +AEYT++ L R +P AVPG+MFLSGGQSE EATLNLNAMN+
Sbjct:  138 ARFAKWRAVLKIGPTEPSPLAILENANGLARYGIICQENGLVPIVEPEILVDGTHDIDRCAEVSERVLAACYKALNDHHVLLEGTSLKPNIVTPGSESK-KVTPEVIAEYTVRTLQRTVPQAVPGVMFLSGGQSEEEATLNLNAMNK 283          
BLAST of CX296383 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 3.980e-42
Identity = 91/147 (61.90%), Postives = 112/147 (76.19%), Query Frame = -2
Query:  249 ARFAKWRTVVSI-PNGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHGIDRTFEVAKKVWAEVFFYLAENNVMFEGILLKPSMVTPGAECKEKATPQQVAEYTLKLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNQ 686
            ARFAKWR V+ I PN PS LA+   A GLARYA I Q+NGLVPIVEPEIL+DG H IDR   V++ V A  +  L E++V+ EG LLKP+MVTPG++ K K +P+ +AEYT++ L R +P AVP I+FLSGGQSE EATLNLNAMN+
Sbjct:  138 ARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAK-KVSPEVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNK 283          
The following BLAST results are available for this feature:
BLAST of CX296383 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
ALFC_ORYSJ4.658e-7576.60Fructose-bisphosphate aldolase, chloroplastic OS=O... [more]
ALFC2_PEA9.713e-7391.78Fructose-bisphosphate aldolase 2, chloroplastic OS... [more]
ALFC1_PEA9.713e-7391.78Fructose-bisphosphate aldolase 1, chloroplastic (F... [more]
ALFC1_ARATH5.330e-7174.32Probable fructose-bisphosphate aldolase 1, chlorop... [more]
ALFC_SPIOL5.879e-7181.51Fructose-bisphosphate aldolase, chloroplastic OS=S... [more]
ALFC2_ARATH6.961e-7189.04Probable fructose-bisphosphate aldolase 2, chlorop... [more]
ALFC3_ARATH1.605e-6785.62Probable fructose-bisphosphate aldolase 3, chlorop... [more]
ALFC_CHLRE8.118e-5871.92Fructose-bisphosphate aldolase 1, chloroplastic OS... [more]
ALF_SPIOL4.702e-4361.90Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ORYSJ3.980e-4261.90Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05139H09SK FerrChloL1 Citrus clementina cDNA clone C05139H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296383 ID=CX296383|Name=CX296383|organism=Citrus clementina|type=EST|length=687bp
GAGGCCTCGTGCCGAATTCGGCACGAGGGCTAAAAGTACATGTAATCATG
AACAAAAATAGTCTCCAAAGCACGGCTATAAAGCATTAACACATTTGAGA
TGACTACTCATTTCAAATTTCTTCACCATTCTTATGATCTTCGTGCTAAC
AAATTTAGTAGGTGTATCCCTTGACGAACATTCCTTTCTTGGCCTCCTCT
GATTCTCCCTCGCCAGTGTACTTGCCGAGCTGAGCAAGTGAGTTGGCCTT
GGTTCATGGCGTTCAAGTTGAGGGTTGCCTCAACCTCAGATTGCCCACCA
GACAAGAACATGATTCCGGGGACAGCTGGAGGGATTCTCCTGTGAAGGAG
CTTGAGTGTGTACTCAGCAACCTGTTGTGGTGTGGCCTTCTCCTTGCATT
CAGCACCAGGAGTGACCATGCTAGGCTTGAGGAGAATACCCTCAAACATG
ACATTGTTCTCAGCAAGGTAGAAGAAAACTTCAGCCCAAACCTTCTTAGC
TACTTCAAAAGTCCTGTCAATGCCATGATCACCATCAAGCAAGATTTCTG
GCTCCACAATTGGGACCAATCCGTTGTCTTGAGCAATGGCAGCATAGCGG
GCAAGACCCCAGGCGGCTTCCTTGACTGCCAAGGCAGATGGGCCATTGGG
AATGCTCACAACAGTACGCCATTTGGCGAAACGAGCT
back to top