CX296384

Overview
NameCX296384
Unique NameCX296384
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length481
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig90 contig Ccv1_Contig90:724..1204. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296384 vs. ExPASy Swiss-Prot
Match: CAHC_PEA (Carbonic anhydrase, chloroplastic OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 2.580e-36
Identity = 68/83 (81.93%), Postives = 75/83 (90.36%), Query Frame = 3
Query:    3 STDFIEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDF 251
            STDFIE+WVKIG+PAK+KV  +HGD PF + CT+CEKEAVN SL NLLTYPFVREGLVNKTLALKGGYYDFV GSFELWGL+F
Sbjct:  238 STDFIEEWVKIGLPAKAKVKAQHGDAPFAELCTHCEKEAVNASLGNLLTYPFVREGLVNKTLALKGGYYDFVKGSFELWGLEF 320          
BLAST of CX296384 vs. ExPASy Swiss-Prot
Match: CAHC_SPIOL (Carbonic anhydrase, chloroplastic OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 145.976 bits (367), Expect = 8.301e-35
Identity = 66/83 (79.52%), Postives = 75/83 (90.36%), Query Frame = 3
Query:    3 STDFIEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDF 251
            +TDFIEDWVKI +PAK KVL EHG+  F +QCT+CEKEAVNVSL NLLTYPFVR+GLV KTLAL+GGYYDFVNGSFELWGL++
Sbjct:  229 TTDFIEDWVKICLPAKHKVLAEHGNATFAEQCTHCEKEAVNVSLGNLLTYPFVRDGLVKKTLALQGGYYDFVNGSFELWGLEY 311          
BLAST of CX296384 vs. ExPASy Swiss-Prot
Match: CAHC_TOBAC (Carbonic anhydrase, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 1.084e-34
Identity = 69/83 (83.13%), Postives = 73/83 (87.95%), Query Frame = 3
Query:    3 STDFIEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDF 251
            ST FIEDWVKIG+PAK+KV  EH DK F DQCT CEKEAVNVSL NLLTYPFVREGLV KTLALKGG+YDFVNG FELWGL+F
Sbjct:  231 STAFIEDWVKIGLPAKAKVQGEHVDKCFADQCTACEKEAVNVSLGNLLTYPFVREGLVKKTLALKGGHYDFVNGGFELWGLEF 313          
BLAST of CX296384 vs. ExPASy Swiss-Prot
Match: CAHC_ARATH (Carbonic anhydrase, chloroplastic OS=Arabidopsis thaliana GN=CA1 PE=1 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 4.555e-33
Identity = 66/83 (79.52%), Postives = 73/83 (87.95%), Query Frame = 3
Query:    3 STDFIEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDF 251
            STDFIEDWVKI +PAKSKV++E GD  F DQC  CE+EAVNVSL+NLLTYPFVREGLV  TLALKGGYYDFV G+FELWGL+F
Sbjct:  246 STDFIEDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALKGGYYDFVKGAFELWGLEF 328          
BLAST of CX296384 vs. ExPASy Swiss-Prot
Match: CAHX_FLABI (Carbonic anhydrase OS=Flaveria bidentis PE=2 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 1.731e-32
Identity = 64/83 (77.11%), Postives = 70/83 (84.34%), Query Frame = 3
Query:    3 STDFIEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDF 251
            STDFIEDWVK+ +PAKSKV+ EH      DQC  CEKEAVNVSL NLLTYPFVR+GL NKTLALKGG+YDFVNG+FELW LDF
Sbjct:  240 STDFIEDWVKVCLPAKSKVVAEHNGTHLDDQCVLCEKEAVNVSLGNLLTYPFVRDGLRNKTLALKGGHYDFVNGTFELWALDF 322          
BLAST of CX296384 vs. ExPASy Swiss-Prot
Match: CAHX_FLAPR (Carbonic anhydrase OS=Flaveria pringlei PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 6.577e-32
Identity = 63/83 (75.90%), Postives = 69/83 (83.13%), Query Frame = 3
Query:    3 STDFIEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDF 251
            STDFIEDWVK+ +PAKSKV+ EH      DQC  CEKEAVNVSL NLLTYPFVR+GL N TLALKGG+YDFVNG+FELW LDF
Sbjct:  239 STDFIEDWVKVCLPAKSKVVAEHNGTHLDDQCVLCEKEAVNVSLGNLLTYPFVRDGLRNNTLALKGGHYDFVNGTFELWALDF 321          
BLAST of CX296384 vs. ExPASy Swiss-Prot
Match: CAHX_FLABR (Carbonic anhydrase OS=Flaveria brownii PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 6.577e-32
Identity = 63/83 (75.90%), Postives = 69/83 (83.13%), Query Frame = 3
Query:    3 STDFIEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDF 251
            STDFIEDWVK+ +PAKSKV+ EH      DQC  CEKEAVNVSL NLLTYPFVR+GL N TLALKGG+YDFVNG+FELW LDF
Sbjct:  240 STDFIEDWVKVCLPAKSKVVAEHNGTHLDDQCVLCEKEAVNVSLGNLLTYPFVRDGLRNNTLALKGGHYDFVNGTFELWALDF 322          
BLAST of CX296384 vs. ExPASy Swiss-Prot
Match: CAH1_FLALI (Carbonic anhydrase 1 OS=Flaveria linearis PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 6.577e-32
Identity = 63/83 (75.90%), Postives = 69/83 (83.13%), Query Frame = 3
Query:    3 STDFIEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDF 251
            STDFIEDWVK+ +PAKSKV+ EH      DQC  CEKEAVNVSL NLLTYPFVR+GL N TLALKGG+YDFVNG+FELW LDF
Sbjct:  240 STDFIEDWVKVCLPAKSKVVAEHNGTHLDDQCVQCEKEAVNVSLGNLLTYPFVRDGLRNNTLALKGGHYDFVNGTFELWALDF 322          
BLAST of CX296384 vs. ExPASy Swiss-Prot
Match: CAH2_ARATH (Carbonic anhydrase 2 OS=Arabidopsis thaliana GN=CA2 PE=1 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 2.499e-31
Identity = 65/83 (78.31%), Postives = 69/83 (83.13%), Query Frame = 3
Query:    3 STDFIEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDF 251
            STDFIEDWVKI +PAKSKVL E     F DQC  CE+EAVNVSL+NLLTYPFVREG+V  TLALKGGYYDFVNGSFELW L F
Sbjct:  169 STDFIEDWVKICLPAKSKVLAESESSAFEDQCGRCEREAVNVSLANLLTYPFVREGVVKGTLALKGGYYDFVNGSFELWELQF 251          
BLAST of CX296384 vs. ExPASy Swiss-Prot
Match: CAH2_FLALI (Carbonic anhydrase 2 (Fragment) OS=Flaveria linearis PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.980e-28
Identity = 57/83 (68.67%), Postives = 67/83 (80.72%), Query Frame = 3
Query:    3 STDFIEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDF 251
            ++DFIE WVK+G+PAKSKV     +  F D CT CEKEAVNVSL NLLTYPFVR+ LVNK L+LKG +YDFVNG+F+LW LDF
Sbjct:  100 ASDFIEQWVKLGLPAKSKVKANCNNLEFADLCTKCEKEAVNVSLGNLLTYPFVRDALVNKKLSLKGAHYDFVNGAFDLWNLDF 182          
The following BLAST results are available for this feature:
BLAST of CX296384 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
CAHC_PEA2.580e-3681.93Carbonic anhydrase, chloroplastic OS=Pisum sativum... [more]
CAHC_SPIOL8.301e-3579.52Carbonic anhydrase, chloroplastic OS=Spinacia oler... [more]
CAHC_TOBAC1.084e-3483.13Carbonic anhydrase, chloroplastic OS=Nicotiana tab... [more]
CAHC_ARATH4.555e-3379.52Carbonic anhydrase, chloroplastic OS=Arabidopsis t... [more]
CAHX_FLABI1.731e-3277.11Carbonic anhydrase OS=Flaveria bidentis PE=2 SV=2[more]
CAHX_FLAPR6.577e-3275.90Carbonic anhydrase OS=Flaveria pringlei PE=2 SV=1[more]
CAHX_FLABR6.577e-3275.90Carbonic anhydrase OS=Flaveria brownii PE=2 SV=1[more]
CAH1_FLALI6.577e-3275.90Carbonic anhydrase 1 OS=Flaveria linearis PE=2 SV=... [more]
CAH2_ARATH2.499e-3178.31Carbonic anhydrase 2 OS=Arabidopsis thaliana GN=CA... [more]
CAH2_FLALI1.980e-2868.67Carbonic anhydrase 2 (Fragment) OS=Flaveria linear... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05139H11SK FerrChloL1 Citrus clementina cDNA clone C05139H11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296384 ID=CX296384|Name=CX296384|organism=Citrus clementina|type=EST|length=481bp
ACTCCACCGATTTCATTGAAGACTGGGTGAAAATTGGCATCCCTGCCAAG
TCTAAGGTGTTAACAGAGCATGGTGACAAGCCTTTTGGAGACCAATGCAC
ATACTGTGAAAAGGAGGCGGTGAATGTGTCCCTCAGTAATCTGCTAACGT
ATCCATTTGTGAGAGAAGGCTTGGTGAACAAAACTCTGGCACTCAAGGGT
GGTTACTATGATTTCGTTAATGGATCATTCGAGCTCTGGGGTCTCGACTT
TAGCCTTTCTCCTCCACTCTCCGTATGAACATCAACCGATATATGATATC
AGTGACCTCATCTTTGTTCTCTTTATTACCATGTGATCTACTTTTATCTC
CCTTTCTTCCCATGTGTACTCTTGTATGTTTTATTGAGCTGCAATTTACA
ATAAACTTACGATGAACATCGGCTTCTACTTCTTTTAACAATAACCTCGT
GCCGGATTCGGCACGAAGGGGGGGGCCCGGT
back to top