CX296509

Overview
NameCX296509
Unique NameCX296509
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length663
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX296509 vs. ExPASy Swiss-Prot
Match: DRP3A_ARATH (Dynamin-related protein 3A OS=Arabidopsis thaliana GN=DRP3A PE=1 SV=2)

HSP 1 Score: 360.918 bits (925), Expect = 3.326e-99
Identity = 180/220 (81.82%), Postives = 203/220 (92.27%), Query Frame = 1
Query:    4 ADTEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSXMVEGKNEEMSTSELSGGARIHYIFQSIF 663
            +D EARIRTMI+SYIKQ +CLILAVTPAN+DLANSDALQIA I DPDG+RTIG+ITKLDIMD+GTDAR LLLG V+PLRLGYVGVVNR QEDI+ NR++K+AL+AEEKFFRS PVY+GLADR GVPQLAKKLNQILVQHIK +LP LKSRIS+ALV+ AKEH SYGE+TES+AGQGALLLN LSKY EA+S ++EGK+EEMSTSELSGGARIHYIFQSIF
Sbjct:  186 SDIEARIRTMILSYIKQDTCLILAVTPANTDLANSDALQIASIVDPDGHRTIGVITKLDIMDKGTDARKLLLGNVVPLRLGYVGVVNRCQEDILLNRTVKEALLAEEKFFRSHPVYHGLADRLGVPQLAKKLNQILVQHIKVLLPDLKSRISNALVATAKEHQSYGELTESRAGQGALLLNFLSKYCEAYSSLLEGKSEEMSTSELSGGARIHYIFQSIF 405          
BLAST of CX296509 vs. ExPASy Swiss-Prot
Match: DRP3B_ARATH (Dynamin-related protein 3B OS=Arabidopsis thaliana GN=DRP3B PE=1 SV=2)

HSP 1 Score: 353.599 bits (906), Expect = 5.311e-97
Identity = 177/220 (80.45%), Postives = 203/220 (92.27%), Query Frame = 1
Query:    4 ADTEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSXMVEGKNEEMSTSELSGGARIHYIFQSIF 663
            +D EARIRTMI++YIK+PSCLILAV+PAN+DLANSDALQIAG ADPDG+RTIG+ITKLDIMDRGTDARN LLGK IPLRLGYVGVVNRSQEDI+ NRSIKDALVAEEKFFRSRPVY+GL DR GVPQLAKKLNQ+LVQHIKA+LP LKSRI++AL + AKE+ SYG+ITES+ GQGALLL+ ++KY EA+S  +EGK++EMSTSELSGGARI YIFQS+F
Sbjct:  171 SDIEARIRTMILTYIKEPSCLILAVSPANTDLANSDALQIAGNADPDGHRTIGVITKLDIMDRGTDARNHLLGKTIPLRLGYVGVVNRSQEDILMNRSIKDALVAEEKFFRSRPVYSGLTDRLGVPQLAKKLNQVLVQHIKALLPSLKSRINNALFATAKEYESYGDITESRGGQGALLLSFITKYCEAYSSTLEGKSKEMSTSELSGGARILYIFQSVF 390          
BLAST of CX296509 vs. ExPASy Swiss-Prot
Match: DYNA_DICDI (Dynamin-A OS=Dictyostelium discoideum GN=dymA PE=1 SV=2)

HSP 1 Score: 227.639 bits (579), Expect = 4.395e-59
Identity = 112/220 (50.91%), Postives = 164/220 (74.55%), Query Frame = 1
Query:    7 DTEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGE-ITESKAGQGALLLNILSKYSEAFSXMVEGKNEEMSTSELSGGARIHYIFQSIF 663
            D E +IR M+M+YIK+ + +I+AVTPAN+DLANSDALQ+A   DP+G RTIG+ITKLD+MD+GTDA  +L G+VIPL LG++GV+NRSQEDI+  +SI+++L +E  +F++ P+Y  +A+R G   L+K LN++L+ HI+  LP LK ++S  L  V  E ++YG+ + ++K  QGALLL I++ +S  F   ++GK  ++S +EL GGARI YIF  I+
Sbjct:  153 DIEQQIRRMVMAYIKKQNAIIVAVTPANTDLANSDALQLAKEVDPEGKRTIGVITKLDLMDKGTDAMEVLTGRVIPLTLGFIGVINRSQEDIIAKKSIRESLKSEILYFKNHPIYKSIANRSGTAYLSKTLNKLLMFHIRDTLPDLKVKVSKMLSDVQGELSTYGDPLYDTKNSQGALLLQIITIFSSNFKDAIDGKLTDLSNNELYGGARISYIFNEIY 372          
BLAST of CX296509 vs. ExPASy Swiss-Prot
Match: DYN1_RAT (Dynamin-1 OS=Rattus norvegicus GN=Dnm1 PE=1 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 1.013e-55
Identity = 114/220 (51.82%), Postives = 150/220 (68.18%), Query Frame = 1
Query:    7 DTEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEI-TESKAGQGALLLNILSKYSEAFSXMVEGKNEEMSTSELSGGARIHYIFQSIF 663
            D E +IR M+M ++ + +CLILAV+PANSDLANSDAL+IA   DP G RTIG+ITKLD+MD GTDAR++L  K++PLR GY+GVVNRSQ+DI   + I  AL AE KFF S P Y  LADR G P L K LNQ L  HI+  LPGL++++ S L+S+ KE   Y     +  A +   LL ++ +++  F   +EG  +++ T ELSGGARI+ IF   F
Sbjct:  151 DIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERF 370          
BLAST of CX296509 vs. ExPASy Swiss-Prot
Match: DYN1_MOUSE (Dynamin-1 OS=Mus musculus GN=Dnm1 PE=1 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 1.013e-55
Identity = 114/220 (51.82%), Postives = 150/220 (68.18%), Query Frame = 1
Query:    7 DTEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEI-TESKAGQGALLLNILSKYSEAFSXMVEGKNEEMSTSELSGGARIHYIFQSIF 663
            D E +IR M+M ++ + +CLILAV+PANSDLANSDAL+IA   DP G RTIG+ITKLD+MD GTDAR++L  K++PLR GY+GVVNRSQ+DI   + I  AL AE KFF S P Y  LADR G P L K LNQ L  HI+  LPGL++++ S L+S+ KE   Y     +  A +   LL ++ +++  F   +EG  +++ T ELSGGARI+ IF   F
Sbjct:  151 DIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERF 370          
BLAST of CX296509 vs. ExPASy Swiss-Prot
Match: DYN1_HUMAN (Dynamin-1 OS=Homo sapiens GN=DNM1 PE=1 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 1.013e-55
Identity = 113/220 (51.36%), Postives = 150/220 (68.18%), Query Frame = 1
Query:    7 DTEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEI-TESKAGQGALLLNILSKYSEAFSXMVEGKNEEMSTSELSGGARIHYIFQSIF 663
            D E +IR M+M ++ + +CLILAV+PANSDLANSDAL++A   DP G RTIG+ITKLD+MD GTDAR++L  K++PLR GY+GVVNRSQ+DI   + I  AL AE KFF S P Y  LADR G P L K LNQ L  HI+  LPGL++++ S L+S+ KE   Y     +  A +   LL ++ +++  F   +EG  +++ T ELSGGARI+ IF   F
Sbjct:  151 DIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERF 370          
BLAST of CX296509 vs. ExPASy Swiss-Prot
Match: DYN1_BOVIN (Dynamin-1 OS=Bos taurus GN=DNM1 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.013e-55
Identity = 113/220 (51.36%), Postives = 150/220 (68.18%), Query Frame = 1
Query:    7 DTEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEI-TESKAGQGALLLNILSKYSEAFSXMVEGKNEEMSTSELSGGARIHYIFQSIF 663
            D E +IR M+M ++ + +CLILAV+PANSDLANSDAL++A   DP G RTIG+ITKLD+MD GTDAR++L  K++PLR GY+GVVNRSQ+DI   + I  AL AE KFF S P Y  LADR G P L K LNQ L  HI+  LPGL++++ S L+S+ KE   Y     +  A +   LL ++ +++  F   +EG  +++ T ELSGGARI+ IF   F
Sbjct:  151 DIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERF 370          
BLAST of CX296509 vs. ExPASy Swiss-Prot
Match: DNM1_YEAST (Dynamin-related protein DNM1 OS=Saccharomyces cerevisiae GN=DNM1 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 8.577e-55
Identity = 100/220 (45.45%), Postives = 158/220 (71.82%), Query Frame = 1
Query:    7 DTEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEI-TESKAGQGALLLNILSKYSEAFSXMVEGKNEEMSTSELSGGARIHYIFQSIF 663
            D E +I+ +I+ YI  P+CLILAV+PAN DL NS++L++A   DP G RTIG+ITKLD+MD GT+A ++L GK+ PL+LG+VGVVNRSQ+DI  N++++++L  EE +FR  PVY  ++ +CG   LAK LNQ L+ HI+  LP +K+++++ +    +E A YG +   +   + +L+L +++K+S  F   ++G + +++T EL GGARI+YI+ ++F
Sbjct:  190 DIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVF 409          
BLAST of CX296509 vs. ExPASy Swiss-Prot
Match: DYN3_HUMAN (Dynamin-3 OS=Homo sapiens GN=DNM3 PE=1 SV=4)

HSP 1 Score: 211.46 bits (537), Expect = 3.259e-54
Identity = 110/220 (50.00%), Postives = 148/220 (67.27%), Query Frame = 1
Query:    7 DTEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEI-TESKAGQGALLLNILSKYSEAFSXMVEGKNEEMSTSELSGGARIHYIFQSIF 663
            D E +IR MIM +I + +CLILAVTPAN+DLANSDAL++A   DP G RTIG+ITKLD+MD GTDAR++L  K++PLR GYVGVVNRSQ+DI   + IK A++AE KFF S P Y  +ADR G P L K LNQ L  HI+  LP  ++++   L+S+  E  +Y     E    +   LL ++ +++  F   +EG  +++ T ELSGGA+I+ IF   F
Sbjct:  151 DIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERF 370          
BLAST of CX296509 vs. ExPASy Swiss-Prot
Match: DYN2_BOVIN (Dynamin-2 OS=Bos taurus GN=DNM2 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 4.257e-54
Identity = 111/220 (50.45%), Postives = 146/220 (66.36%), Query Frame = 1
Query:    7 DTEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEI-TESKAGQGALLLNILSKYSEAFSXMVEGKNEEMSTSELSGGARIHYIFQSIF 663
            D E +I+ MI+ +I + S LILAVTPAN DLANSDAL++A   DP G RTIG+ITKLD+MD GTDAR++L  K++PLR GY+GVVNRSQ+DI   + I+ AL AE KFF S P Y  +ADR G P L K LNQ L  HI+  LP L+S++ S L+S+ KE   Y     +    +   LL ++ ++   F   +EG  +++ T ELSGGARI+ IF   F
Sbjct:  151 DIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRTALAAERKFFLSHPAYRHIADRMGTPHLQKTLNQQLTNHIRESLPALRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERF 370          
The following BLAST results are available for this feature:
BLAST of CX296509 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
DRP3A_ARATH3.326e-9981.82Dynamin-related protein 3A OS=Arabidopsis thaliana... [more]
DRP3B_ARATH5.311e-9780.45Dynamin-related protein 3B OS=Arabidopsis thaliana... [more]
DYNA_DICDI4.395e-5950.91Dynamin-A OS=Dictyostelium discoideum GN=dymA PE=1... [more]
DYN1_RAT1.013e-5551.82Dynamin-1 OS=Rattus norvegicus GN=Dnm1 PE=1 SV=2[more]
DYN1_MOUSE1.013e-5551.82Dynamin-1 OS=Mus musculus GN=Dnm1 PE=1 SV=2[more]
DYN1_HUMAN1.013e-5551.36Dynamin-1 OS=Homo sapiens GN=DNM1 PE=1 SV=2[more]
DYN1_BOVIN1.013e-5551.36Dynamin-1 OS=Bos taurus GN=DNM1 PE=2 SV=1[more]
DNM1_YEAST8.577e-5545.45Dynamin-related protein DNM1 OS=Saccharomyces cere... [more]
DYN3_HUMAN3.259e-5450.00Dynamin-3 OS=Homo sapiens GN=DNM3 PE=1 SV=4[more]
DYN2_BOVIN4.257e-5450.45Dynamin-2 OS=Bos taurus GN=DNM2 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05142A12SK FerrChloL1 Citrus clementina cDNA clone C05142A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296509 ID=CX296509|Name=CX296509|organism=Citrus clementina|type=EST|length=663bp
GAGGCTGATACTGAAGCACGAATTAGAACGATGATTATGTCATATATCAA
GCAACCAAGTTGTCTAATTCTTGCAGTTACACCGGCAAATTCAGATTTGG
CAAACTCAGATGCCCTTCAAATTGCTGGAATTGCTGATCCGGATGGTTAT
AGAACCATAGGCATAATCACAAAGTTGGATATTATGGACAGAGGTACTGA
TGCCCGTAATTTGTTACTCGGAAAAGTGATTCCGCTTCGGCTTGGTTATG
TTGGTGTTGTGAATAGGAGTCAGGAGGATATTATGTTCAACCGGAGTATC
AAGGATGCACTAGTGGCTGAGGAAAAGTTCTTCCGTAGTCGCCCTGTATA
TAATGGTCTAGCAGATCGTTGTGGTGTTCCTCAGTTGGCAAAGAAGTTGA
ACCAGATTCTTGTACAACATATCAAGGCTATACTTCCTGGGTTGAAGTCA
CGCATTAGCTCTGCATTAGTTTCTGTTGCAAAGGAGCATGCAAGCTACGG
GGAAATCACAGAATCAAAGGCTGGTCAGGGAGCTCTACTCCTGAATATTC
TTTCTAAATACTCCGAAGCATTTTCTTNCATGGTGGAGGGAAAGAATGAA
GAAATGTCAACATCTGAGCTTTCTGGCGGGGCACGAATTCACTATATTTT
TCAGTCAATCTTT
back to top