CX296514

Overview
NameCX296514
Unique NameCX296514
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length661
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX296514_ssr404 microsatellite CX296514_ssr404:404..424. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15080 contig Ccv1_Contig15080:21..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296514 vs. ExPASy Swiss-Prot
Match: EF104_ARATH (Ethylene-responsive transcription factor ERF104 OS=Arabidopsis thaliana GN=ERF104 PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.552e-31
Identity = 85/205 (41.46%), Postives = 110/205 (53.66%), Query Frame = 1
Query:   31 MASLNEASTLELISQYLLADQYFTSSIDHTHSFKNISNLPQSPSLFNNPXXXXXXXXXXXXXDRDNINSRNKPSSTLKQRKPACVKNVTIPQTTSFNLMSCSNVNDDADNPVAVKNKDPXXXXXXXXXXXXXXIEEKHYRGVRRRPWGRYAAEIRDPNRKGSRVWLGTFDTAVEAAKAYDNSAFRLRGSKAILNFPLEVGGTLDS 645
            MA+  EA  ++ ISQ+LL D + +   DH             PSLF N               R   N   KP+STL QRKP  + N+++ +T                  V+ K +                 EE+HYRGVRRRPWG+YAAEIRDPN+KG R+WLGT+DTAVEA +AYD +AF+LRG KAILNFPL+V  T ++
Sbjct:    1 MATKQEALAIDFISQHLLTD-FVSMETDH-------------PSLFTNQLHNFHSETGP----RTITNQSPKPNSTLNQRKPP-LPNLSVSRT------------------VSTKTEKEE--------------EERHYRGVRRRPWGKYAAEIRDPNKKGCRIWLGTYDTAVEAGRAYDQAAFQLRGRKAILNFPLDVRVTSET 154          
BLAST of CX296514 vs. ExPASy Swiss-Prot
Match: EF102_ARATH (Ethylene-responsive transcription factor 5 OS=Arabidopsis thaliana GN=ERF5 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 4.696e-29
Identity = 65/129 (50.39%), Postives = 84/129 (65.12%), Query Frame = 1
Query:  244 KPSSTLKQRKPACVKNVTIPQTTSFNLMSCSNVNDDADNPVAVKNKDPXXXXXXXXXXXXXXIEEKHYRGVRRRPWGRYAAEIRDPNRKGSRVWLGTFDTAVEAAKAYDNSAFRLRGSKAILNFPLEVG 630
            +P    + RKP     +++P  T +   +  N   +   PV+ +                   E+KHYRGVR+RPWG++AAEIRDPN++GSRVWLGTFDTA+EAA+AYD +AFRLRGSKAILNFPLEVG
Sbjct:  110 EPELKSQIRKPPL--KISLPAKTEWIQFAAENTKPEVTKPVSEE-------------------EKKHYRGVRQRPWGKFAAEIRDPNKRGSRVWLGTFDTAIEAARAYDEAAFRLRGSKAILNFPLEVG 217          
BLAST of CX296514 vs. ExPASy Swiss-Prot
Match: ERF5_NICSY (Ethylene-responsive transcription factor 5 OS=Nicotiana sylvestris GN=ERF5 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.133e-29
Identity = 89/229 (38.86%), Postives = 116/229 (50.66%), Query Frame = 1
Query:   31 MASLNEAST-LELISQYLLADQYF---------------------TSSIDHTHSFK---NISNLPQSPSL-----FNNPXXXXXXXXXXXXXDRDNINSRNKPSSTLKQRKPACVKNVTIPQTTSFNLMSCSNVNDDADNPVAVKNKDPXXXXXXXXXXXXXXIEEKHYRGVRRRPWGRYAAEIRDPNRKGSRVWLGTFDTAVEAAKAYDNSAFRLRGSKAILNFPLEV 627
            MAS  E ST L+LI Q+LL D  F                     + S+D + SF+   N +   QS +L     FNN              +     S +   ++ K+RKP+   N+ IP            V  +    V +                    E+KHYRGVR+RPWG++AAEIRDPNRKG+RVWLGTFDTA+EAAKAYD +A++LRGSKAI+NFPLEV
Sbjct:    1 MASPQENSTTLDLIRQHLLDDNVFLEHYCSETETTTLIYSQSSSSSESLDQSFSFEPTLNYATTAQSSNLEVSTFFNNSKTEFDSFEFGTIPNVSAARSSSLKQTSFKERKPSL--NIAIP------------VKQEVVQKVELA-----------------PTEKKHYRGVRQRPWGKFAAEIRDPNRKGTRVWLGTFDTAIEAAKAYDRAAYKLRGSKAIVNFPLEV 198          
BLAST of CX296514 vs. ExPASy Swiss-Prot
Match: ERF5_TOBAC (Ethylene-responsive transcription factor 5 OS=Nicotiana tabacum GN=ERF5 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 5.192e-28
Identity = 55/65 (84.62%), Postives = 64/65 (98.46%), Query Frame = 1
Query:  433 EEKHYRGVRRRPWGRYAAEIRDPNRKGSRVWLGTFDTAVEAAKAYDNSAFRLRGSKAILNFPLEV 627
            E+KHYRGVR+RPWG++AAEIRDPNRKG+RVWLGTFDTA+EAAKAYD +AF+LRGSKAI+NFPLEV
Sbjct:  141 EKKHYRGVRQRPWGKFAAEIRDPNRKGTRVWLGTFDTAIEAAKAYDRAAFKLRGSKAIVNFPLEV 205          
BLAST of CX296514 vs. ExPASy Swiss-Prot
Match: EF105_ARATH (Ethylene-responsive transcription factor ERF105 OS=Arabidopsis thaliana GN=ERF105 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.365e-27
Identity = 53/66 (80.30%), Postives = 62/66 (93.94%), Query Frame = 1
Query:  433 EEKHYRGVRRRPWGRYAAEIRDPNRKGSRVWLGTFDTAVEAAKAYDNSAFRLRGSKAILNFPLEVG 630
            +++HYRGVRRRPWG+YAAEIRDPN+KG RVWLGTFDTA+EAA+ YD +AF+LRGSKAILNFPLE G
Sbjct:   68 DQRHYRGVRRRPWGKYAAEIRDPNKKGVRVWLGTFDTAMEAARGYDKAAFKLRGSKAILNFPLEAG 133          
BLAST of CX296514 vs. ExPASy Swiss-Prot
Match: EF103_ARATH (Ethylene-responsive transcription factor 6 OS=Arabidopsis thaliana GN=ERF6 PE=2 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 1.670e-26
Identity = 79/216 (36.57%), Postives = 101/216 (46.76%), Query Frame = 1
Query:   31 MASLNEASTLELISQYLLAD--------------QYFTSSIDHTHSFKNISNLPQSPSLFNNPXXXXXXXXXXXXXDRDNIN---SRNKPSSTLKQRKPACVKNVTIPQTTSFNLMSCSNVNDDADNPVAVKNKDPXXXXXXXXXXXXXXIEEKHYRGVRRRPWGRYAAEIRDPNRKGSRVWLGTFDTAVEAAKAYDNSAFRLRGSKAILNFPLEV 627
            MA+ NE S L LI +YLL +                FTS       F      P+   L                    N +     N P  T++  +   +K +  P  T +   +  N   +   PV                      E++HYRGVR RPWG++AAEIRDP R+G+RVWLGTF+TA+EAA+AYD  AFRLRGSKAILNFPLEV
Sbjct:    1 MATPNEVSALFLIKKYLLDELSPLPTTATTNRWMNDFTSFDQTGFEFSEFETKPEIIDLVTPKPEIFDFDVKSEIPSESNDSFTFQSNPPRVTVQSNRKPPLK-IAPPNRTKWIQFATGNPKPELPVPVVAAE------------------EKRHYRGVRMRPWGKFAAEIRDPTRRGTRVWLGTFETAIEAARAYDKEAFRLRGSKAILNFPLEV 197          
BLAST of CX296514 vs. ExPASy Swiss-Prot
Match: EF107_ARATH (Ethylene-responsive transcription factor ERF107 OS=Arabidopsis thaliana GN=ERF107 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 7.758e-24
Identity = 46/66 (69.70%), Postives = 60/66 (90.91%), Query Frame = 1
Query:  433 EEKHYRGVRRRPWGRYAAEIRDPNRKGSRVWLGTFDTAVEAAKAYDNSAFRLRGSKAILNFPLEVG 630
            E +HYRGVRRRPWG++AAEIRDP +KGSR+WLGTF++ ++AA+AYD +AF+LRG KA+LNFPL+ G
Sbjct:  103 ETRHYRGVRRRPWGKFAAEIRDPAKKGSRIWLGTFESDIDAARAYDYAAFKLRGRKAVLNFPLDAG 168          
BLAST of CX296514 vs. ExPASy Swiss-Prot
Match: EF106_ARATH (Ethylene-responsive transcription factor ERF106 OS=Arabidopsis thaliana GN=ERF106 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 7.758e-24
Identity = 46/67 (68.66%), Postives = 61/67 (91.04%), Query Frame = 1
Query:  430 IEEKHYRGVRRRPWGRYAAEIRDPNRKGSRVWLGTFDTAVEAAKAYDNSAFRLRGSKAILNFPLEVG 630
            ++ +HYRGVRRRPWG++AAEIRDP +KGSR+WLGTF++ V+AA+AYD +AF+LRG KA+LNFPL+ G
Sbjct:  105 VDARHYRGVRRRPWGKFAAEIRDPAKKGSRIWLGTFESDVDAARAYDCAAFKLRGRKAVLNFPLDAG 171          
BLAST of CX296514 vs. ExPASy Swiss-Prot
Match: EF100_ARATH (Ethylene-responsive transcription factor 1A OS=Arabidopsis thaliana GN=ERF1A PE=1 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 1.120e-22
Identity = 56/128 (43.75%), Postives = 76/128 (59.38%), Query Frame = 1
Query:  244 KPSSTLKQRKPACVKNVTIPQTTSFNLMSCSNVNDDADNPVAVKNKDPXXXXXXXXXXXXXXIEEKHYRGVRRRPWGRYAAEIRDPNRKGSRVWLGTFDTAVEAAKAYDNSAFRLRGSKAILNFPLEV 627
            +PSS+      +   +V I    SF  +    V  +  +PV+                     + KHYRGVR+RPWG++AAEIRDP + G+RVWLGTF+TA +AA AYD +AFR+RGS+A+LNFPL V
Sbjct:   96 EPSSSSSDEDRSSFPSVKIETPESFAAVDSVPVKKEKTSPVSAA---------------VTAAKGKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRV 208          
BLAST of CX296514 vs. ExPASy Swiss-Prot
Match: EF101_ARATH (Ethylene-responsive transcription factor 2 OS=Arabidopsis thaliana GN=ERF2 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.463e-22
Identity = 46/66 (69.70%), Postives = 59/66 (89.39%), Query Frame = 1
Query:  430 IEEKHYRGVRRRPWGRYAAEIRDPNRKGSRVWLGTFDTAVEAAKAYDNSAFRLRGSKAILNFPLEV 627
            ++ KHYRGVR+RPWG++AAEIRDP + G+RVWLGTF+TA +AA AYD +AFR+RGS+A+LNFPL V
Sbjct:  112 VKAKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDIAAFRMRGSRALLNFPLRV 177          
The following BLAST results are available for this feature:
BLAST of CX296514 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 119
Match NameE-valueIdentityDescription
EF104_ARATH6.552e-3141.46Ethylene-responsive transcription factor ERF104 OS... [more]
EF102_ARATH4.696e-2950.39Ethylene-responsive transcription factor 5 OS=Arab... [more]
ERF5_NICSY6.133e-2938.86Ethylene-responsive transcription factor 5 OS=Nico... [more]
ERF5_TOBAC5.192e-2884.62Ethylene-responsive transcription factor 5 OS=Nico... [more]
EF105_ARATH3.365e-2780.30Ethylene-responsive transcription factor ERF105 OS... [more]
EF103_ARATH1.670e-2636.57Ethylene-responsive transcription factor 6 OS=Arab... [more]
EF107_ARATH7.758e-2469.70Ethylene-responsive transcription factor ERF107 OS... [more]
EF106_ARATH7.758e-2468.66Ethylene-responsive transcription factor ERF106 OS... [more]
EF100_ARATH1.120e-2243.75Ethylene-responsive transcription factor 1A OS=Ara... [more]
EF101_ARATH1.463e-2269.70Ethylene-responsive transcription factor 2 OS=Arab... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05142C04SK FerrChloL1 Citrus clementina cDNA clone C05142C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296514 ID=CX296514|Name=CX296514|organism=Citrus clementina|type=EST|length=661bp
GAGGCATTTACCTTTCATCTTACCTTCAATATGGCATCTCTGAATGAAGC
ATCAACTTTAGAACTCATCAGCCAGTATCTTCTCGCTGATCAGTACTTCA
CTTCTTCAATTGATCATACCCATAGCTTCAAAAATATCTCAAACCTTCCT
CAAAGCCCGAGCTTATTCAACAACCCAACAACAACTACAACAGCAACAAC
AGTTACTACTACAACTGATCGTGATAATATAAACAGCAGAAACAAGCCTT
CAAGCACTTTAAAACAACGGAAGCCGGCCTGTGTAAAAAACGTAACCATA
CCCCAAACTACAAGCTTCAATTTGATGAGCTGCTCCAATGTTAATGATGA
TGCTGATAACCCAGTTGCTGTGAAAAATAAAGATCCGGATGCTGCTGCTG
ATGATAATAATAATAATAATAATAACAATATTGAGGAAAAGCATTACAGA
GGAGTAAGGAGACGGCCGTGGGGCAGGTATGCAGCTGAAATCCGGGACCC
GAATAGAAAAGGGAGCCGGGTTTGGCTTGGAACTTTTGATACTGCCGTTG
AAGCCGCCAAAGCTTATGACAACTCTGCGTTTAGGCTGCGTGGAAGCAAA
GCGATATTGAATTTCCCTCTCGAAGTTGGCGGGACTTTGGATTCTAAAGT
GGAAGTTGACC
back to top