CX296529

Overview
NameCX296529
Unique NameCX296529
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length666
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX296529_ssr600 microsatellite CX296529_ssr600:600..626. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15181 contig Ccv1_Contig15181:27..692. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296529 vs. ExPASy Swiss-Prot
Match: LEA14_GOSHI (Late embryogenesis abundant protein Lea14-A OS=Gossypium hirsutum GN=LEA14-A PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 2.941e-63
Identity = 116/151 (76.82%), Postives = 136/151 (90.07%), Query Frame = 2
Query:  104 MAQFLDKAKNFVAEKMANIEKPEAEITDVDLKNVSREAVEYDAKVSVDNPYSHSLPICEISYTFKSAGKVIASGTMADPGSLKGNDKTLLQVPMKVPPNILVSLAKDIGADWDIDYEVELGLTIDLPIIGNFTIPLSKKGEFKLPSLSDIF 556
            M+Q L+KAK+FV +K+ANI+KPEA ++DVDLK+VSRE VEY AKVSV NPYSHS+PICEISY F+SAG+ IASGT+ DPGSLK +D T+L VP+KVP NILVSL KDIGADWDIDYE+ELGLTIDLPI+GNFTIPLS+KGE KLP+LSDIF
Sbjct:    1 MSQLLEKAKDFVVDKVANIKKPEASVSDVDLKHVSRECVEYGAKVSVSNPYSHSIPICEISYNFRSAGRGIASGTIPDPGSLKASDTTMLDVPVKVPYNILVSLVKDIGADWDIDYELELGLTIDLPIVGNFTIPLSQKGEIKLPTLSDIF 151          
BLAST of CX296529 vs. ExPASy Swiss-Prot
Match: LEA14_SOYBN (Desiccation protectant protein Lea14 homolog OS=Glycine max PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 4.395e-59
Identity = 109/151 (72.19%), Postives = 131/151 (86.75%), Query Frame = 2
Query:  104 MAQFLDKAKNFVAEKMANIEKPEAEITDVDLKNVSREAVEYDAKVSVDNPYSHSLPICEISYTFKSAGKVIASGTMADPGSLKGNDKTLLQVPMKVPPNILVSLAKDIGADWDIDYEVELGLTIDLPIIGNFTIPLSKKGEFKLPSLSDIF 556
            M+Q LDKAKN+VAEK+ N+ KPEA +TDVD K VSR++VEY AKVSV NPYS  +PICEI Y+ KSAGK IASGT+ DPGSLK +D T+L VP+KVP +IL+SLAKDIGADWDIDY+++LGL IDLP+IGNFTIPLS+KGE KLP+LSD+F
Sbjct:    1 MSQLLDKAKNYVAEKVTNMPKPEASVTDVDFKRVSRDSVEYLAKVSVSNPYSTPIPICEIKYSLKSAGKEIASGTIPDPGSLKASDTTMLDVPVKVPHSILLSLAKDIGADWDIDYQLDLGLVIDLPVIGNFTIPLSQKGEIKLPTLSDMF 151          
BLAST of CX296529 vs. ExPASy Swiss-Prot
Match: DRPD_CRAPL (Desiccation-related protein PCC27-45 OS=Craterostigma plantagineum PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 7.261e-54
Identity = 101/151 (66.89%), Postives = 123/151 (81.46%), Query Frame = 2
Query:  104 MAQFLDKAKNFVAEKMANIEKPEAEITDVDLKNVSREAVEYDAKVSVDNPYSHSLPICEISYTFKSAGKVIASGTMADPGSLKGNDKTLLQVPMKVPPNILVSLAKDIGADWDIDYEVELGLTIDLPIIGNFTIPLSKKGEFKLPSLSDIF 556
            MAQ ++KAKNFVAEK+AN+EKP+A + DVDLK+V R  + Y  ++ V+NPYS S+P+ EI YT KSAG+VI SG + DPGSLKGNDKT+L+  +KVP + LVSL KDIGAD DIDY +ELGL +DLP+IGNFTIPLS KGE KLP LSDIF
Sbjct:    1 MAQLMNKAKNFVAEKVANVEKPKASVEDVDLKDVGRHGITYLTRICVENPYSASIPVGEIKYTLKSAGRVIVSGNIPDPGSLKGNDKTMLEPAIKVPHSALVSLIKDIGADMDIDYVLELGLVVDLPVIGNFTIPLSHKGEMKLPGLSDIF 151          
BLAST of CX296529 vs. ExPASy Swiss-Prot
Match: LEA14_ARATH (Probable desiccation-related protein LEA14 OS=Arabidopsis thaliana GN=LEA14 PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 3.604e-53
Identity = 96/151 (63.58%), Postives = 121/151 (80.13%), Query Frame = 2
Query:  104 MAQFLDKAKNFVAEKMANIEKPEAEITDVDLKNVSREAVEYDAKVSVDNPYSHSLPICEISYTFKSAGKVIASGTMADPGSLKGNDKTLLQVPMKVPPNILVSLAKDIGADWDIDYEVELGLTIDLPIIGNFTIPLSKKGEFKLPSLSDIF 556
            MA  LDKAK+FVA+K+  I KPE  +TDVDLK+V+R++VEY AKVSV NPYSHS+PICEIS+TF SAG+ I  G + DPGSLK  D T L +P+ VP +IL +LA+D+G DWDIDYE+++GLTIDLP++G FTIP+S KGE KLP+  D F
Sbjct:    1 MASLLDKAKDFVADKLTAIPKPEGSVTDVDLKDVNRDSVEYLAKVSVTNPYSHSIPICEISFTFHSAGREIGKGKIPDPGSLKAKDMTALDIPVVVPYSILFNLARDVGVDWDIDYELQIGLTIDLPVVGEFTIPISSKGEIKLPTFKDFF 151          
BLAST of CX296529 vs. ExPASy Swiss-Prot
Match: LEA2R_ARATH (Desiccation-related protein At2g46140 OS=Arabidopsis thaliana GN=At2g46140 PE=1 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 5.954e-48
Identity = 92/163 (56.44%), Postives = 123/163 (75.46%), Query Frame = 2
Query:   68 EIVKKKLRIEEDMAQFLDKAKNFVAEKMANIEKPEAEITDVDLKNVSREAVEYDAKVSVDNPYSHSLPICEISYTFKSAGKVIASGTMADPGSLKGNDKTLLQVPMKVPPNILVSLAKDIGADWDIDYEVELGLTIDLPIIGNFTIPLSKKGEFKLPSLSDIF 556
            ++V++K  +   ++  LDKAK F AEK+ANI  PEA + DVD K V+R+ V+Y AKVSV NPYS S+PIC+ISY  KSA + IASGT+ DPGSL G+  T+L VP+KV  +I VSL KD+  DWDIDY++++GLT D+P++G+ TIP+S +GE KLPSL D F
Sbjct:    7 KVVEEKASV---ISSLLDKAKGFFAEKLANIPTPEATVDDVDFKGVTRDGVDYHAKVSVKNPYSQSIPICQISYILKSATRTIASGTIPDPGSLVGSGTTVLDVPVKVAYSIAVSLMKDMCTDWDIDYQLDIGLTFDIPVVGDITIPVSTQGEIKLPSLRDFF 166          
The following BLAST results are available for this feature:
BLAST of CX296529 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
LEA14_GOSHI2.941e-6376.82Late embryogenesis abundant protein Lea14-A OS=Gos... [more]
LEA14_SOYBN4.395e-5972.19Desiccation protectant protein Lea14 homolog OS=Gl... [more]
DRPD_CRAPL7.261e-5466.89Desiccation-related protein PCC27-45 OS=Craterosti... [more]
LEA14_ARATH3.604e-5363.58Probable desiccation-related protein LEA14 OS=Arab... [more]
LEA2R_ARATH5.954e-4856.44Desiccation-related protein At2g46140 OS=Arabidops... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05142E10SK FerrChloL1 Citrus clementina cDNA clone C05142E10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296529 ID=CX296529|Name=CX296529|organism=Citrus clementina|type=EST|length=666bp
TTCGGCCGAGGCAATCTCATCCAGATAACCCTTGTGGTCTGTTTACACTG
TGTGTCCGAATTAAATCGAAATTGTAAAGAAGAAGTTGAGAATAGAAGAA
GATATGGCGCAGTTCTTGGACAAGGCGAAGAACTTCGTGGCAGAGAAGAT
GGCAAACATAGAGAAGCCAGAGGCTGAAATCACAGACGTCGATCTCAAGA
ACGTCAGTCGTGAAGCCGTCGAGTACGACGCCAAGGTCTCCGTTGATAAC
CCCTACAGCCATTCTCTTCCCATTTGTGAGATCTCCTACACTTTCAAAAG
CGCCGGCAAAGTGATAGCGTCGGGAACAATGGCGGACCCGGGCTCTCTGA
AAGGGAACGACAAGACCTTGCTGCAGGTGCCGATGAAGGTGCCCCCCAAC
ATCCTGGTGAGCTTGGCCAAGGACATTGGAGCCGACTGGGATATTGATTA
TGAGGTGGAGCTGGGTCTCACCATTGATCTCCCTATCATCGGCAACTTCA
CCATTCCTCTCTCTAAGAAAGGAGAGTTCAAGCTTCCTTCTCTCTCTGAT
ATTTTTTAGTTTAGCTTAGTTTGTCTCTCCCTTTGCGAGCTTGTTACATT
AATAATAATAATAATAATAATAATAATGGACTATGATATCCATCCAGCCT
AAAAAAAAAAAAAAAA
back to top