CX296568

Overview
NameCX296568
Unique NameCX296568
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length542
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX296568 vs. ExPASy Swiss-Prot
Match: ACCO_PRUMU (1-aminocyclopropane-1-carboxylate oxidase OS=Prunus mume GN=ACO1 PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.529e-60
Identity = 116/136 (85.29%), Postives = 126/136 (92.65%), Query Frame = 2
Query:    5 LALQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNGKYKSVEHRVISQTDGEGRMSLASFYNPGSDAVIYPAPALLEKEAEKK-QVYPKFVFEDYMKLYVPLKFQAKEPRFEAMKAVETNVNLGPIATA 409
            L  QDDKVSGLQLLKDGQWIDVPP+RHSIV+NLGDQ+EVITNGKY+SVEHRVI+QTDG  RMS+ASFYNPGSDAVIYPAP L+EKEAE+K QVYPKFVFEDYMKLY  LKFQ KEPRFEAMKAVETN++L PIATA
Sbjct:  185 LLFQDDKVSGLQLLKDGQWIDVPPMRHSIVINLGDQLEVITNGKYRSVEHRVIAQTDGT-RMSIASFYNPGSDAVIYPAPTLVEKEAEEKNQVYPKFVFEDYMKLYAGLKFQPKEPRFEAMKAVETNISLVPIATA 319          
BLAST of CX296568 vs. ExPASy Swiss-Prot
Match: ACCO_DIOKA (1-aminocyclopropane-1-carboxylate oxidase OS=Diospyros kaki GN=DK-ACO1 PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 1.997e-60
Identity = 112/134 (83.58%), Postives = 124/134 (92.54%), Query Frame = 2
Query:    5 LALQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNGKYKSVEHRVISQTDGEGRMSLASFYNPGSDAVIYPAPALLEKEAEKKQVYPKFVFEDYMKLYVPLKFQAKEPRFEAMKAVETNVNLGPIAT 406
            L  QDDKVSGLQLLKD QWIDVPP++HSIV+NLGDQ+EVITNGKYKSV HRV++QTDG  RMS+ASFYNPG+DAVIYPAPAL+EKE E+K+VYPKFVF+DYMKLY  LKFQAKEPRFEAMKAVE NVNLGPIAT
Sbjct:  185 LLFQDDKVSGLQLLKDDQWIDVPPMKHSIVINLGDQLEVITNGKYKSVLHRVVAQTDGT-RMSIASFYNPGNDAVIYPAPALVEKEVEEKEVYPKFVFDDYMKLYAALKFQAKEPRFEAMKAVEANVNLGPIAT 317          
BLAST of CX296568 vs. ExPASy Swiss-Prot
Match: ACCO1_PETHY (1-aminocyclopropane-1-carboxylate oxidase 1 OS=Petunia hybrida GN=ACO1 PE=1 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 3.767e-59
Identity = 115/135 (85.19%), Postives = 124/135 (91.85%), Query Frame = 2
Query:    5 LALQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNGKYKSVEHRVISQTDGEGRMSLASFYNPGSDAVIYPAPALLEKEAEK-KQVYPKFVFEDYMKLYVPLKFQAKEPRFEAMKAVETNVNLGPIAT 406
            L  QDDKVSGLQLLKDGQWIDVPP+RHSIVVNLGDQ+EVITNGKYKSV HRVI+Q DG  RMSLASFYNPGSDAVIYPAPAL+EKEAE+ KQVYPKFVF+DYMKLY  LKFQAKEPRFEAMKA+ET+V + PIAT
Sbjct:  185 LLFQDDKVSGLQLLKDGQWIDVPPMRHSIVVNLGDQLEVITNGKYKSVMHRVIAQKDG-ARMSLASFYNPGSDAVIYPAPALVEKEAEENKQVYPKFVFDDYMKLYAGLKFQAKEPRFEAMKAMETDVKMDPIAT 318          
BLAST of CX296568 vs. ExPASy Swiss-Prot
Match: ACCO1_ARATH (1-aminocyclopropane-1-carboxylate oxidase OS=Arabidopsis thaliana GN=ACO PE=2 SV=2)

HSP 1 Score: 226.483 bits (576), Expect = 6.426e-59
Identity = 111/139 (79.86%), Postives = 127/139 (91.37%), Query Frame = 2
Query:    5 LALQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNGKYKSVEHRVISQTDGEGRMSLASFYNPGSDAVIYPAPALLEKEA--EKKQVYPKFVFEDYMKLYVPLKFQAKEPRFEAMKAVETNV--NLGPIATA 409
            L  QDDKVSGLQLLKDG+W+DVPP++HSIVVNLGDQ+EVITNGKYKSVEHRV+SQTDGEGRMS+ASFYNPGSD+VI+PAP L+ KEA  EKK+ YP+FVFEDYMKLY  +KFQAKEPRFEAMKA+ET V  N+GP+ATA
Sbjct:  185 LLFQDDKVSGLQLLKDGEWVDVPPVKHSIVVNLGDQLEVITNGKYKSVEHRVLSQTDGEGRMSIASFYNPGSDSVIFPAPELIGKEAEKEKKENYPRFVFEDYMKLYSAVKFQAKEPRFEAMKAMETTVANNVGPLATA 323          
BLAST of CX296568 vs. ExPASy Swiss-Prot
Match: ACCO3_PETHY (1-aminocyclopropane-1-carboxylate oxidase 3 OS=Petunia hybrida GN=ACO3 PE=3 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.212e-57
Identity = 114/137 (83.21%), Postives = 122/137 (89.05%), Query Frame = 2
Query:    5 LALQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNGKYKSVEHRVISQTDGEGRMSLASFYNPGSDAVIYPAPALLEKEAEK--KQVYPKFVFEDYMKLYVPLKFQAKEPRFEAMKAVETNVNLGPIATA 409
            L  QDDKVSGLQLLKDGQWIDVPP+RHSIVVNLGDQ+EVITNGKYKSV HRVI+QTDG  RMSLASFYNPGSDAVIYPAP L+EKEA++  KQVYPKFVF+DYMKLY  LKFQAKEPRFEAMKA E +V   PIATA
Sbjct:  185 LLFQDDKVSGLQLLKDGQWIDVPPMRHSIVVNLGDQLEVITNGKYKSVLHRVIAQTDGT-RMSLASFYNPGSDAVIYPAPTLVEKEADQECKQVYPKFVFDDYMKLYAGLKFQAKEPRFEAMKAREADVKSDPIATA 320          
BLAST of CX296568 vs. ExPASy Swiss-Prot
Match: ACCO1_CUCME (1-aminocyclopropane-1-carboxylate oxidase 1 OS=Cucumis melo GN=ACO1 PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.212e-57
Identity = 110/137 (80.29%), Postives = 123/137 (89.78%), Query Frame = 2
Query:    5 LALQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNGKYKSVEHRVISQTDGEGRMSLASFYNPGSDAVIYPAPALLEK--EAEKKQVYPKFVFEDYMKLYVPLKFQAKEPRFEAMKAVETNVNLGPIATA 409
            L  QDDKVSGLQLLKDG WIDVPP+RH+IVVNLGDQ+EVITNG+YKSV HRV++QT G GRMS+ASFYNPGSDAVIYPAPAL+EK  + EKK+VYPKFVFEDYMKLY+ +KFQAKEPRFEAMKA   N NLGP+ATA
Sbjct:  185 LLFQDDKVSGLQLLKDGNWIDVPPMRHAIVVNLGDQLEVITNGRYKSVMHRVLTQTSGTGRMSIASFYNPGSDAVIYPAPALVEKDQDEEKKEVYPKFVFEDYMKLYLGVKFQAKEPRFEAMKA---NANLGPMATA 318          
BLAST of CX296568 vs. ExPASy Swiss-Prot
Match: ACCO_ACTDE (1-aminocyclopropane-1-carboxylate oxidase OS=Actinidia deliciosa GN=ACO PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 7.855e-57
Identity = 108/135 (80.00%), Postives = 123/135 (91.11%), Query Frame = 2
Query:    5 LALQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNGKYKSVEHRVISQTDGEGRMSLASFYNPGSDAVIYPAPALLEKEA-EKKQVYPKFVFEDYMKLYVPLKFQAKEPRFEAMKAVETNVNLGPIAT 406
            L  QD+KVSGLQLLKDG+WIDVPP++HSIV+N+GDQ+EVITNGKYKSV HRVI+Q DG  RMS+ASFYNPGSDAV+YPAPAL++KE  ++KQVYPKFVFEDYMKLY  LKFQAKEPRFEAMKA+E  VNLGPIAT
Sbjct:  185 LLFQDNKVSGLQLLKDGEWIDVPPMKHSIVINIGDQLEVITNGKYKSVMHRVIAQPDG-NRMSIASFYNPGSDAVMYPAPALVDKEEDQQKQVYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAMENAVNLGPIAT 318          
BLAST of CX296568 vs. ExPASy Swiss-Prot
Match: ACCO4_PETHY (1-aminocyclopropane-1-carboxylate oxidase 4 OS=Petunia hybrida GN=ACO4 PE=3 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.026e-56
Identity = 108/135 (80.00%), Postives = 122/135 (90.37%), Query Frame = 2
Query:    5 LALQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNGKYKSVEHRVISQTDGEGRMSLASFYNPGSDAVIYPAPALLEKEAEK-KQVYPKFVFEDYMKLYVPLKFQAKEPRFEAMKAVETNVNLGPIAT 406
            L  QDDKVSGLQLLKD QWIDVPP+RHSIV+NLGDQ+EVITNGKYKSV HRVI+QTDG  RMSLASFYNP SDAVIYPAPAL+E++AE+ KQ+YPKFVF+DYMKLY  LKFQAKEPRFEAMKA+E +V + P+AT
Sbjct:  185 LLFQDDKVSGLQLLKDDQWIDVPPMRHSIVINLGDQLEVITNGKYKSVPHRVIAQTDGT-RMSLASFYNPASDAVIYPAPALVERDAEENKQIYPKFVFDDYMKLYARLKFQAKEPRFEAMKAMEADVKIDPVAT 318          
BLAST of CX296568 vs. ExPASy Swiss-Prot
Match: ACCO3_CUCME (1-aminocyclopropane-1-carboxylate oxidase 3 OS=Cucumis melo GN=ACO3 PE=2 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 3.898e-56
Identity = 106/135 (78.52%), Postives = 122/135 (90.37%), Query Frame = 2
Query:    5 LALQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNGKYKSVEHRVISQTDGEGRMSLASFYNPGSDAVIYPAPALLEKEAEKKQVYPKFVFEDYMKLYVPLKFQAKEPRFEAMKAVE-TNVNLGPIAT 406
            L  QDDKVSGL +LKDG+W+DVPP+ HSIV+NLGDQ+EVITNGKYKSV HRVI+Q DG  RMS+ASFYNPG+DAVIYPAPAL+E E EK ++YPKFVF+DYMKLYV LKFQAKEPRFEAMKA+E TN+N+GPIAT
Sbjct:  186 LLFQDDKVSGLHVLKDGKWVDVPPMHHSIVINLGDQLEVITNGKYKSVMHRVIAQEDGN-RMSIASFYNPGNDAVIYPAPALVEGEQEKTKLYPKFVFDDYMKLYVGLKFQAKEPRFEAMKAMESTNLNMGPIAT 319          
BLAST of CX296568 vs. ExPASy Swiss-Prot
Match: ACCO_DIACA (Probable 1-aminocyclopropane-1-carboxylate oxidase OS=Dianthus caryophyllus GN=ACO PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 3.300e-55
Identity = 107/135 (79.26%), Postives = 117/135 (86.67%), Query Frame = 2
Query:    5 LALQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNGKYKSVEHRVISQTDGEGRMSLASFYNPGSDAVIYPAPALLEKEAEKKQVYPKFVFEDYMKLYVPLKFQAKEPRFEAMKAVETNVNLGPIATA 409
            L  QDDKVSGLQLLKDG W+DVPP++HSIVVNLGDQ+EVITNGKYKSV HRVI+QTDG  RMS+ASFYNPGSDAVIYPAP L+EKE EK + YPKFVFEDYM LY+ LKFQ KEPRFEAMKA+ET    GPI TA
Sbjct:  191 LLFQDDKVSGLQLLKDGHWVDVPPMKHSIVVNLGDQLEVITNGKYKSVMHRVIAQTDGN-RMSIASFYNPGSDAVIYPAPTLVEKEEEKCRAYPKFVFEDYMNLYLKLKFQEKEPRFEAMKAMETT---GPIPTA 321          
The following BLAST results are available for this feature:
BLAST of CX296568 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
ACCO_PRUMU1.529e-6085.291-aminocyclopropane-1-carboxylate oxidase OS=Prunu... [more]
ACCO_DIOKA1.997e-6083.581-aminocyclopropane-1-carboxylate oxidase OS=Diosp... [more]
ACCO1_PETHY3.767e-5985.191-aminocyclopropane-1-carboxylate oxidase 1 OS=Pet... [more]
ACCO1_ARATH6.426e-5979.861-aminocyclopropane-1-carboxylate oxidase OS=Arabi... [more]
ACCO3_PETHY1.212e-5783.211-aminocyclopropane-1-carboxylate oxidase 3 OS=Pet... [more]
ACCO1_CUCME1.212e-5780.291-aminocyclopropane-1-carboxylate oxidase 1 OS=Cuc... [more]
ACCO_ACTDE7.855e-5780.001-aminocyclopropane-1-carboxylate oxidase OS=Actin... [more]
ACCO4_PETHY1.026e-5680.001-aminocyclopropane-1-carboxylate oxidase 4 OS=Pet... [more]
ACCO3_CUCME3.898e-5678.521-aminocyclopropane-1-carboxylate oxidase 3 OS=Cuc... [more]
ACCO_DIACA3.300e-5579.26Probable 1-aminocyclopropane-1-carboxylate oxidase... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05146B12SK FerrChloL1 Citrus clementina cDNA clone C05146B12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296568 ID=CX296568|Name=CX296568|organism=Citrus clementina|type=EST|length=542bp
GAGGCTTGCTCTTCAGGATGACAAAGTCAGTGGCCTTCAGCTTCTTAAAG
ATGGCCAGTGGATTGATGTGCCCCCATTGCGCCACTCCATTGTTGTCAAC
CTCGGTGACCAAATTGAGGTGATCACCAATGGAAAGTACAAGAGTGTGGA
GCACAGAGTGATTTCTCAAACCGACGGCGAGGGCCGGATGTCCCTAGCTT
CATTCTACAATCCTGGAAGTGATGCTGTGATCTATCCAGCACCAGCATTG
CTTGAAAAAGAAGCTGAGAAGAAACAAGTGTACCCAAAATTTGTTTTTGA
GGACTACATGAAGCTCTATGTTCCCCTCAAGTTCCAGGCCAAGGAACCAA
GATTTGAAGCCATGAAAGCTGTGGAAACTAATGTTAACTTGGGTCCAATT
GCCACCGCTTAAACTATTATTTTATAGCCAAATTATTTTTATCTGCTGGA
GTGGTGTGACATCCATTTATATTATTTGTAGACAGTAACAAATGTAACTA
CTCTGTGATAGTAGTCTCTTCCAAATAAAGGGGGGGCCCGGT
back to top