CX296576

Overview
NameCX296576
Unique NameCX296576
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length676
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig694 contig Ccv1_Contig694:1..676. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296576 vs. ExPASy Swiss-Prot
Match: GI1L3_ARATH (Probable gibberellin receptor GID1L3 OS=Arabidopsis thaliana GN=GID1L3 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.691e-35
Identity = 96/218 (44.04%), Postives = 126/218 (57.80%), Query Frame = 2
Query:   71 LPWKAWLSISTLSFAMQICFRRNMTVNRFLFNLYDRK--SSPSTKNGVTSFDVSVDATRDLWFRLYSP----TNTTATNL---------PVIVYFHGGGFAILAANSKVYDDACRRLAVEVPAVVISVNYRRSPEHRCPSQYEDGIDALKFIDSSFIDIENFPACADIK-QCFLAGDSAGGNLAHNVAVLADGCNFSRLRLNGLIAIQPFFGGEERTE 676
            +P   W+ IS    A  +  R + T NR L    DRK  ++ +  NGV SFDV +D   +L  R+Y P    T+ + T+L         PVIV+FHGG FA  +ANS +YD  CRRL     AVV+SVNYRR+PE+R P  Y+DG   LK+++SS        +  D K + FLAGDS+GGN+ HNVAV A     SR+ + G I + P FGG ERTE
Sbjct:   16 VPLNTWVLISNFKLAYNLLRRPDGTFNRHLAEFLDRKVPANANPVNGVFSFDVIIDRQTNLLSRVYRPADAGTSPSITDLQNPVDGEIVPVIVFFHGGSFAHSSANSAIYDTLCRRLVGLCGAVVVSVNYRRAPENRYPCAYDDGWAVLKWVNSS----SWLRSKKDSKVRIFLAGDSSGGNIVHNVAVRAVE---SRIDVLGNILLNPMFGGTERTE 226          
BLAST of CX296576 vs. ExPASy Swiss-Prot
Match: GI1L2_ARATH (Probable gibberellin receptor GID1L2 OS=Arabidopsis thaliana GN=GID1L2 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.079e-31
Identity = 84/220 (38.18%), Postives = 121/220 (55.00%), Query Frame = 2
Query:   71 LPWKAWLSISTLSFAMQICFRRNMTVNRFLFNLYDRKSSPST--KNGVTSFDVSVDATRDLWFRLYSPTN----------------TTATNLPVIVYFHGGGFAILAANSKVYDDACRRLAVEVPAVVISVNYRRSPEHRCPSQYEDGIDALKFIDSSFIDIENFPACADIKQCFLAGDSAGGNLAHNVAVLADGCNFSRLRLNGLIAIQPFFGGEERTE 676
            +P   W+ IS    A ++  R + + NR L    DRK   ++   +GV SFD  VD+T +L  R+Y P +                +T   +PV+++FHGG F   +ANS +YD  CRRL      VV+SV+YRRSPEHR P  Y+DG +AL ++ S         +   +   +LAGDS+GGN+AHNVAV A       +++ G I + P FGG+ERT+
Sbjct:   16 VPLNTWVLISNFKLAYKVLRRPDGSFNRDLAEFLDRKVPANSFPLDGVFSFD-HVDSTTNLLTRIYQPASLLHQTRHGTLELTKPLSTTEIVPVLIFFHGGSFTHSSANSAIYDTFCRRLVTICGVVVVSVDYRRSPEHRYPCAYDDGWNALNWVKSRVWLQSGKDSNVYV---YLAGDSSGGNIAHNVAVRATN---EGVKVLGNILLHPMFGGQERTQ 228          
BLAST of CX296576 vs. ExPASy Swiss-Prot
Match: GI1L1_ARATH (Probable gibberellin receptor GID1L1 OS=Arabidopsis thaliana GN=GID1L1 PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 8.957e-31
Identity = 89/221 (40.27%), Postives = 119/221 (53.85%), Query Frame = 2
Query:   71 LPWKAWLSISTLSFAMQICFRRNMTVNRFLFNLYDRKSSPSTK--NGVTSFDVSVDATRDLWFRLYSPTNTTATN---------------LPVIVYFHGGGFAILAANSKVYDDACRRLAVEVPAVVISVNYRRSPEHRCPSQYEDGIDALKFIDS-SFIDIENFPACADIK-QCFLAGDSAGGNLAHNVAVLADGCNFSRLRLNGLIAIQPFFGGEERTE 676
            +P   W+ IS    A  I  R + T NR L    DRK + +    +GV SFDV +D   +L  R+Y P                      +PVI++FHGG FA  +ANS +YD  CRRL      VV+SVNYRR+PE+  P  Y+DG  AL +++S S++  +      D K   FLAGDS+GGN+AHNVA+ A     S + + G I + P FGG ERTE
Sbjct:   16 VPLNTWVLISNFKVAYNILRRPDGTFNRHLAEYLDRKVTANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNSRSWLKSKK-----DSKVHIFLAGDSSGGNIAHNVALRA---GESGIDVLGNILLNPMFGGNERTE 228          
BLAST of CX296576 vs. ExPASy Swiss-Prot
Match: GID1_ORYSJ (Gibberellin receptor GID1 OS=Oryza sativa subsp. japonica GN=GID1 PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 7.847e-27
Identity = 81/226 (35.84%), Postives = 111/226 (49.12%), Query Frame = 2
Query:   71 LPWKAWLSISTLSFAMQICFRRNMTVNRFLFNLYDRKSSPSTK--NGVTSFDVSVDATRDLWFRLYSPTNT----------------------TATNLPVIVYFHGGGFAILAANSKVYDDACRRLAVEVPAVVISVNYRRSPEHRCPSQYEDGIDALKFIDSSFIDIENFPACADIKQCFLAGDSAGGNLAHNVAVLADGCNFSRLRLNGLIAIQPFFGGEERTE 676
            +P   W+ IS    +  I  R + T  R L    DR+   + +   GV+SFD  +D +  L  R+Y                            A   PVI++FHGG F   +A+S +YD  CRR       VV+SVNYRR+PEHR P  Y+DG  ALK++ S         A A +   FL+GDS+GGN+AH+VAV A       +++ G I +   FGG ERTE
Sbjct:   16 VPLHTWVLISNFKLSYNILRRADGTFERDLGEYLDRRVPANARPLEGVSSFDHIIDQSVGLEVRIYRAAAEGDAEEGAAAVTRPILEFLTDAPAAEPFPVIIFFHGGSFVHSSASSTIYDSLCRRFVKLSKGVVVSVNYRRAPEHRYPCAYDDGWTALKWVMSQPFMRSGGDAQARV---FLSGDSSGGNIAHHVAVRAAD---EGVKVCGNILLNAMFGGTERTE 235          
BLAST of CX296576 vs. ExPASy Swiss-Prot
Match: ADCL2_HUMAN (Arylacetamide deacetylase-like 2 OS=Homo sapiens GN=AADACL2 PE=2 SV=3)

HSP 1 Score: 79.337 bits (194), Expect = 2.005e-14
Identity = 42/111 (37.84%), Postives = 64/111 (57.66%), Query Frame = 2
Query:  242 DLWFRLYSPTNTTATNLPVIVYFHGGGFAILAANSKVYDDACRRLAVEVPAVVISVNYRRSPEHRCPSQYEDGIDALKFIDSSFIDIENFPACADIKQCFLAGDSAGGNLA 574
            D+  RLY P   + T    ++YFHGGGF   ++  + +D   R  A  + AVV+ V+YR +P+H  P+Q+EDG+ A+KF     ++        D  +  +AGDS+GGNLA
Sbjct:   88 DIPVRLYLPKRKSETRRRAVIYFHGGGFCFGSSKQRAFDFLNRWTANTLDAVVVGVDYRLAPQHHFPAQFEDGLAAVKFF---LLEKILTKYGVDPTRICIAGDSSGGNLA 195          
BLAST of CX296576 vs. ExPASy Swiss-Prot
Match: AAAD_RABIT (Arylacetamide deacetylase OS=Oryctolagus cuniculus GN=AADAC PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.100e-12
Identity = 51/150 (34.00%), Postives = 79/150 (52.67%), Query Frame = 2
Query:  137 NMTVNRFLFNLYDRKSSPSTKNGVTSFDVSVDATRDLWFRLYSPTNTTATNLPVIVYFHGGGFAILAANSKVYDDACRRLAVEVPAVVISVNYRRSPEHRCPSQYEDGIDALKFIDSSFIDIENFPACADIKQCFLAGDSAGGNLAHNVA 586
            N+ +N   F    ++  P++   VT   V+     ++  R+Y P   + T    + Y HGGG+ + +A    YD   RR A  +  VV+S NYR +PE+  P Q+ED  DALK+     + +E +    D ++  ++GDSAGGNLA  VA
Sbjct:   55 NIFMNTVKFLTSFQEVPPTSDENVT---VTETTFNNVPVRVYVPKRKSKTLRRGLFYIHGGGWCVGSAALSGYDLLSRRTADRLDVVVVSTNYRLAPEYHFPIQFEDVYDALKWFLRQDV-LEKYG--VDPERVGVSGDSAGGNLAAAVA 198          
BLAST of CX296576 vs. ExPASy Swiss-Prot
Match: AAAD_BOVIN (Arylacetamide deacetylase OS=Bos taurus GN=AADAC PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.201e-12
Identity = 65/203 (32.02%), Postives = 102/203 (50.25%), Query Frame = 2
Query:   74 PWKAWLSISTLSFAMQIC-FRRNMTVNRFLFN--LYDRKSS--PSTKNGVTSFDVSVDATRDLWFRLYSPTNTTATNLPVIVYFHGGGFAILAANSKVYDDACRRLAVEVPAVVISVNYRRSPEHRCPSQYEDGIDALKFIDSSFIDIENFPAC-ADIKQCFLAGDSAGGNLAHNVA--VLADGCNFSRLRLNGLI--AIQPF 652
            PWK  L  + L  +  +  F   + +N F+ +  L+ R     P++   +   D + +   D+  R+Y P   T +    + Y HGGG+   + +   YD   R  A  + AVVIS NYR +P++  P Q+ED   ALK+    F+D +N  +   D  +  ++GDSAGGNLA  VA  +L D     +L++  LI  A+Q F
Sbjct:   30 PWKIMLLNTFLKTSSYLALFGEILGLNHFMKSMALFSRIQGFPPTSDENIIVKDTTFN---DIPVRIYVPQQKTKSLRRGLFYIHGGGWCFGSNDYYSYDLLSRWTAERLDAVVISTNYRLAPKYHFPVQFEDVYTALKW----FLDPQNLESYGVDPGRIGISGDSAGGNLAAAVAQQLLEDPDVKIKLKVQTLIYPALQNF 225          
BLAST of CX296576 vs. ExPASy Swiss-Prot
Match: NCEH1_BOVIN (Neutral cholesterol ester hydrolase 1 OS=Bos taurus GN=NCEH1 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 2.709e-11
Identity = 53/175 (30.29%), Postives = 79/175 (45.14%), Query Frame = 2
Query:   74 PWKAWLSISTLSFAMQIC-------FRRNMTVNRFLFNLYDRKSSPSTKNGVTSFDVSVDATRDLWFRLYSPTNTTATNLPVIVYFHGGGFAILAANSKVYDDACRRLAVEVPAVVISVNYRRSPEHRCPSQYEDGIDALKFIDSSFIDIENF-PACADIKQCFLAGDSAGGNLA 574
            PWK  L  +T   A Q+           ++    F+   + +KS+ S+   V   D   D      F    P          IVY HGGG+A+ +A  + YD+ C  +A E+ AV++S+ YR  P+   P Q  D + A K+    F+  E       D  +  ++GDSAGGNLA
Sbjct:   30 PWKLMLLDATFRSAQQVSNLIHFLGLSHHLLALNFIIVSFGKKSAWSSAQ-VKVTDTDFDGVEVRVFE--GPPKPEEPLKRSIVYIHGGGWALASAKIRYYDELCTTMAEELNAVIVSIEYRLVPKVYFPEQIHDVVHATKY----FLQPEVLHKYSVDPGRVGISGDSAGGNLA 197          
BLAST of CX296576 vs. ExPASy Swiss-Prot
Match: NCEH1_RAT (Neutral cholesterol ester hydrolase 1 OS=Rattus norvegicus GN=Nceh1 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.539e-11
Identity = 53/175 (30.29%), Postives = 77/175 (44.00%), Query Frame = 2
Query:   74 PWKAWLSISTLSFAMQIC-------FRRNMTVNRFLFNLYDRKSSPSTKNGVTSFDVSVDATRDLWFRLYSPTNTTATNLPVIVYFHGGGFAILAANSKVYDDACRRLAVEVPAVVISVNYRRSPEHRCPSQYEDGIDALK-FIDSSFIDIENFPACADIKQCFLAGDSAGGNLA 574
            PWK  L  +T   A Q+           ++    F+   + +KS+ S+   V   D   D      F    P          +VY HGGG+A+ +A    YD  C  +A E+ AV++S+ YR  P+   P Q  D I A K F+    +D        D  +  ++GDSAGGNLA
Sbjct:   30 PWKLMLLDATFRGAQQVSNLIHSLGLSHHLITLNFIIISFGKKSARSSPR-VKVTDTDFDGVEVRVFE--GPPKPDEPLRRSVVYIHGGGWALASAKISYYDQLCTAMAEELNAVIVSIEYRLVPQVYFPEQIHDVIRATKYFLQPEVLDKYK----VDPGRVGVSGDSAGGNLA 197          
BLAST of CX296576 vs. ExPASy Swiss-Prot
Match: NCEH1_HUMAN (Neutral cholesterol ester hydrolase 1 OS=Homo sapiens GN=NCEH1 PE=1 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 3.539e-11
Identity = 55/197 (27.92%), Postives = 89/197 (45.18%), Query Frame = 2
Query:   74 PWKAWLSISTLSFAMQIC-------FRRNMTVNRFLFNLYDRKSSPSTKNGVTSFDVSVDATRDLWFRLYSPTNTTATNLPVIVYFHGGGFAILAANSKVYDDACRRLAVEVPAVVISVNYRRSPEHRCPSQYEDGIDALKFIDSSFIDIENFPACADIKQCFLAGDSAGGNLAHNVA--VLADGCNFSRLRLNGLI 637
            PWK  L  +T   A Q+           ++    F+   + +KS+ S+   V   D   D      F    P          +VY HGGG+A+ +A  + YD+ C  +A E+ AV++S+ YR  P+   P Q  D + A K+     + ++ +    D  +  ++GDSAGGNLA  +      D    ++L+L  LI
Sbjct:   30 PWKLMLLDATFRGAQQVSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAQ-VKVTDTDFDGVEVRVFE--GPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEV-LQKY--MVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALI 220          
The following BLAST results are available for this feature:
BLAST of CX296576 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
GI1L3_ARATH2.691e-3544.04Probable gibberellin receptor GID1L3 OS=Arabidopsi... [more]
GI1L2_ARATH3.079e-3138.18Probable gibberellin receptor GID1L2 OS=Arabidopsi... [more]
GI1L1_ARATH8.957e-3140.27Probable gibberellin receptor GID1L1 OS=Arabidopsi... [more]
GID1_ORYSJ7.847e-2735.84Gibberellin receptor GID1 OS=Oryza sativa subsp. j... [more]
ADCL2_HUMAN2.005e-1437.84Arylacetamide deacetylase-like 2 OS=Homo sapiens G... [more]
AAAD_RABIT1.100e-1234.00Arylacetamide deacetylase OS=Oryctolagus cuniculus... [more]
AAAD_BOVIN3.201e-1232.02Arylacetamide deacetylase OS=Bos taurus GN=AADAC P... [more]
NCEH1_BOVIN2.709e-1130.29Neutral cholesterol ester hydrolase 1 OS=Bos tauru... [more]
NCEH1_RAT3.539e-1130.29Neutral cholesterol ester hydrolase 1 OS=Rattus no... [more]
NCEH1_HUMAN3.539e-1127.92Neutral cholesterol ester hydrolase 1 OS=Homo sapi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05146C09SK FerrChloL1 Citrus clementina cDNA clone C05146C09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296576 ID=CX296576|Name=CX296576|organism=Citrus clementina|type=EST|length=676bp
GATTCGGCCGAGGCCTCGTGCCGAATTCGGCACGAGGATAATGTCCACGA
ATTCCAAAACTTCACCAAACCTCCCATGGAAGGCATGGCTCTCCATATCG
ACGCTCTCCTTTGCCATGCAAATATGTTTCCGCCGCAACATGACTGTCAA
TCGTTTCCTCTTTAACCTCTATGATCGCAAATCCTCTCCTTCAACCAAAA
ATGGCGTCACGAGCTTCGATGTCTCAGTCGACGCCACCCGGGATCTCTGG
TTCCGCCTCTACTCGCCCACCAACACGACTGCAACAAACTTGCCAGTCAT
CGTCTACTTCCACGGCGGAGGATTTGCAATCCTTGCTGCCAATTCAAAAG
TATACGATGATGCTTGTAGAAGGCTAGCTGTGGAAGTCCCGGCTGTCGTC
ATTTCCGTTAACTATCGTCGTTCGCCGGAGCATCGGTGTCCAAGTCAATA
CGAAGATGGGATTGATGCACTCAAATTCATTGACAGCAGCTTCATAGACA
TTGAAAACTTTCCGGCTTGTGCTGATATCAAACAGTGTTTTCTTGCCGGA
GATAGTGCCGGAGGCAACTTGGCCCATAACGTGGCAGTTCTTGCTGATGG
GTGTAATTTTTCCAGGCTGAGACTTAATGGACTCATAGCGATACAGCCAT
TTTTCGGCGGTGAAGAAAGGACTGAA
back to top