CX296726

Overview
NameCX296726
Unique NameCX296726
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length724
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12872 contig Ccv1_Contig12872:500..1223. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296726 vs. ExPASy Swiss-Prot
Match: GAPN_ARATH (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Arabidopsis thaliana GN=ALDH11A3 PE=1 SV=2)

HSP 1 Score: 439.884 bits (1130), Expect = 6.598e-123
Identity = 218/241 (90.46%), Postives = 226/241 (93.78%), Query Frame = 1
Query:    1 ERTKYCLTSNIPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPAVNCISFTGGDTGISISKKAGMIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLVMESVADSLXXXXXXXXXXLTVGPPEESCDITPVVSESSANFIEGLVMDAKQKGATFCQEYRREGNLIWPLLLDNVRPDMRI 723
            +RTKYCLTS IPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAV+ LHMVHCFHLAGFPKGLISC+TGKGSEIGDFLTMHPAVNCISFTGGDTGISISKKAGMIPLQMELGGKDACIVL+DADLDLVA+NIIKGGFSYSGQRCTAVKVVLVMESVAD L          LTVGPPEE+ DIT VVSESSANFIEGLVMDAK+KGATFCQEY+REGNLIWPLLLDNVRPDMRI
Sbjct:  147 DRTKYCLTSKIPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVSCLHMVHCFHLAGFPKGLISCITGKGSEIGDFLTMHPAVNCISFTGGDTGISISKKAGMIPLQMELGGKDACIVLDDADLDLVASNIIKGGFSYSGQRCTAVKVVLVMESVADELVEKVKAKVAKLTVGPPEENSDITAVVSESSANFIEGLVMDAKEKGATFCQEYKREGNLIWPLLLDNVRPDMRI 387          
BLAST of CX296726 vs. ExPASy Swiss-Prot
Match: GAPN_PEA (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Pisum sativum GN=GAPN PE=1 SV=1)

HSP 1 Score: 439.113 bits (1128), Expect = 1.125e-122
Identity = 217/241 (90.04%), Postives = 226/241 (93.78%), Query Frame = 1
Query:    1 ERTKYCLTSNIPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPAVNCISFTGGDTGISISKKAGMIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLVMESVADSLXXXXXXXXXXLTVGPPEESCDITPVVSESSANFIEGLVMDAKQKGATFCQEYRREGNLIWPLLLDNVRPDMRI 723
            ERTKYCLTS IPLGV+LAIPPFNYPVNLAVSKIAPALIAGNS+VLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHP VNCISFTGGDTGI+ISKK+GMIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLVMESVAD+L          L+VGPPE+  DITPVVSESSANFIEGLV DAK+KGATFCQEY+REGNLIWPLLLDNVRPDMRI
Sbjct:  147 ERTKYCLTSKIPLGVILAIPPFNYPVNLAVSKIAPALIAGNSIVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPGVNCISFTGGDTGIAISKKSGMIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLVMESVADALVEKVKVKVAKLSVGPPEDDSDITPVVSESSANFIEGLVNDAKEKGATFCQEYKREGNLIWPLLLDNVRPDMRI 387          
BLAST of CX296726 vs. ExPASy Swiss-Prot
Match: GAPN_NICPL (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Nicotiana plumbaginifolia GN=GAPN PE=2 SV=1)

HSP 1 Score: 437.573 bits (1124), Expect = 3.275e-122
Identity = 214/241 (88.80%), Postives = 224/241 (92.95%), Query Frame = 1
Query:    1 ERTKYCLTSNIPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPAVNCISFTGGDTGISISKKAGMIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLVMESVADSLXXXXXXXXXXLTVGPPEESCDITPVVSESSANFIEGLVMDAKQKGATFCQEYRREGNLIWPLLLDNVRPDMRI 723
            ERTKYCLTS IPLGV+LAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVA LHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHP V+CISFTGGDTG++ISKKAGMIPLQMELGGKDACIVLEDADLDL A +I+KGGFSYSGQRCTAVKVVLVMESVAD+L          LTVGPPE+ CDITPVVSESSANFIEGLVMDAKQK ATFCQ+Y+REGNLIWPLLLDNVRPDMRI
Sbjct:  147 ERTKYCLTSKIPLGVILAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVACLHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPGVHCISFTGGDTGVAISKKAGMIPLQMELGGKDACIVLEDADLDLAAGSIVKGGFSYSGQRCTAVKVVLVMESVADALVEKVNAKVAKLTVGPPEDDCDITPVVSESSANFIEGLVMDAKQKNATFCQQYKREGNLIWPLLLDNVRPDMRI 387          
BLAST of CX296726 vs. ExPASy Swiss-Prot
Match: GAPN_APIGR (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Apium graveolens PE=1 SV=1)

HSP 1 Score: 433.721 bits (1114), Expect = 4.728e-121
Identity = 209/241 (86.72%), Postives = 225/241 (93.36%), Query Frame = 1
Query:    1 ERTKYCLTSNIPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPAVNCISFTGGDTGISISKKAGMIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLVMESVADSLXXXXXXXXXXLTVGPPEESCDITPVVSESSANFIEGLVMDAKQKGATFCQEYRREGNLIWPLLLDNVRPDMRI 723
            ERTKYCLTS IPLGV+LAIPPFNYPVNLAVSKI PALIAGN+LVLKPPTQGAVA LHMVHCFHLAGFPKGLISC+TGKGSEIGDFLTMHP VNCISFTGGDTGI+ISKKAGM+PLQMELGGKDACIVLEDADLDLVA+N+IKGGFSYSGQRCTA+KV+LVM+SVAD+L          LTVGPPE++ DITPVVSESSANFIEGLV DAK+KGATFCQEY+REGNLIWPLLLDNV+PDMRI
Sbjct:  147 ERTKYCLTSKIPLGVILAIPPFNYPVNLAVSKIGPALIAGNALVLKPPTQGAVACLHMVHCFHLAGFPKGLISCITGKGSEIGDFLTMHPGVNCISFTGGDTGIAISKKAGMVPLQMELGGKDACIVLEDADLDLVASNVIKGGFSYSGQRCTAIKVILVMQSVADTLVEKVNAKVAKLTVGPPEDNSDITPVVSESSANFIEGLVKDAKEKGATFCQEYKREGNLIWPLLLDNVKPDMRI 387          
BLAST of CX296726 vs. ExPASy Swiss-Prot
Match: GAPN_WHEAT (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Triticum aestivum GN=GAPN PE=1 SV=2)

HSP 1 Score: 432.565 bits (1111), Expect = 1.053e-120
Identity = 211/241 (87.55%), Postives = 224/241 (92.95%), Query Frame = 1
Query:    1 ERTKYCLTSNIPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPAVNCISFTGGDTGISISKKAGMIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLVMESVADSLXXXXXXXXXXLTVGPPEESCDITPVVSESSANFIEGLVMDAKQKGATFCQEYRREGNLIWPLLLDNVRPDMRI 723
            ER KYCL+S +PLGVVLAIPPFNYPVNLAVSKI PALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHP VNCISFTGGDTGI+ISKKAGM+PLQMELGGKDACIVLEDADLDLVAANI+KGGFSYSGQRCTAVKVVL+ME+VAD++          L VGPPE+  DITPVV+ESSANFIEGLVMDAK+KGATFCQEYRREGNLIWPLLLD+VRPDMRI
Sbjct:  147 ERNKYCLSSKVPLGVVLAIPPFNYPVNLAVSKIGPALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPGVNCISFTGGDTGIAISKKAGMVPLQMELGGKDACIVLEDADLDLVAANIVKGGFSYSGQRCTAVKVVLIMEAVADTVVEKVNAKLAKLKVGPPEDDSDITPVVTESSANFIEGLVMDAKEKGATFCQEYRREGNLIWPLLLDHVRPDMRI 387          
BLAST of CX296726 vs. ExPASy Swiss-Prot
Match: GAPN_MAIZE (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Zea mays GN=GPN1 PE=2 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 4.426e-119
Identity = 208/241 (86.31%), Postives = 222/241 (92.12%), Query Frame = 1
Query:    1 ERTKYCLTSNIPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPAVNCISFTGGDTGISISKKAGMIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLVMESVADSLXXXXXXXXXXLTVGPPEESCDITPVVSESSANFIEGLVMDAKQKGATFCQEYRREGNLIWPLLLDNVRPDMRI 723
            ER KYCL+S IPLGVVLAIPPFNYP NLA SKI PALIAGN+LVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHP VNCISFTGGDTGI+ISKKAGM+PLQMELGGKDACIVLEDADLDLV+ANI+KGGFSYSGQRCTAVKVVL+MES+AD++          L VGPPE+  DITPVV+ESSANFIEGLVMDAK+KGATFCQEYRREGNLIWPLLLD+VRPDMRI
Sbjct:  149 ERNKYCLSSKIPLGVVLAIPPFNYPANLAGSKIGPALIAGNALVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPGVNCISFTGGDTGIAISKKAGMVPLQMELGGKDACIVLEDADLDLVSANIVKGGFSYSGQRCTAVKVVLIMESIADAVVQKVNAKLAKLKVGPPEDDSDITPVVTESSANFIEGLVMDAKEKGATFCQEYRREGNLIWPLLLDHVRPDMRI 389          
BLAST of CX296726 vs. ExPASy Swiss-Prot
Match: GAPN_SCEVA (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Scenedesmus vacuolatus GN=GapN PE=2 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 1.214e-92
Identity = 165/225 (73.33%), Postives = 188/225 (83.56%), Query Frame = 1
Query:   49 LAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPAVNCISFTGGDTGISISKKAGMIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLVMESVADSLXXXXXXXXXXLTVGPPEESCDITPVVSESSANFIEGLVMDAKQKGATFCQEYRREGNLIWPLLLDNVRPDMRI 723
            LAIPPFNYPVNLAVSK+APAL+AGN++VLKPP+QG VA +HM+ CF  AG P G ++ VTGKGSEIGDFLT HPAVNCISFTGGDTGI+IS+KAGM+PLQMELGGKDACIV  DADLDL A +IIKGGFSYSGQRCTAVKVVLVM+ +AD L          L VG PE++ DIT VVSE SANFI+GLV DAK KGATF  +++REGNL+WP+LLDNV  DMRI
Sbjct:    1 LAIPPFNYPVNLAVSKLAPALMAGNTVVLKPPSQGVVAGIHMIKCFQAAGLPAGTVNLVTGKGSEIGDFLTTHPAVNCISFTGGDTGIAISRKAGMVPLQMELGGKDACIVCSDADLDLAATHIIKGGFSYSGQRCTAVKVVLVMQDIADELVRKVHAGVQKLKVGRPEDNADITAVVSEGSANFIQGLVEDAKAKGATFLTDWKREGNLLWPVLLDNVTADMRI 225          
BLAST of CX296726 vs. ExPASy Swiss-Prot
Match: GAPN_STRMU (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus mutans GN=gapN PE=1 SV=2)

HSP 1 Score: 266.544 bits (680), Expect = 9.998e-71
Identity = 138/242 (57.02%), Postives = 169/242 (69.83%), Query Frame = 1
Query:    4 RTKYCLTSNIPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPAVNCISFTGGDTGIS--ISKKAGMIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLVMESVADSLXXXXXXXXXXLTVGPPEESCDITPVVSESSANFIEGLVMDAKQKGATFCQEYRREGNLIWPLLLDNVRPDMRI 723
            + K  +    P+G+VLAI PFNYPVNLA SKIAPALIAGN +  KPPTQG+++ L +   F  AG P G+ + +TG+GSEIGD++  H AVN I+FTG  TGI   I K AGM P+ +ELGGKD+ IVLEDADL+L A NII G F YSGQRCTAVK VLVMESVAD L          LT+G PE+  DITP++   SA+++EGL+ DA  KGA    E +REGNLI P+L D V  DMR+
Sbjct:  133 KKKIAVVRREPVGLVLAISPFNYPVNLAGSKIAPALIAGNVIAFKPPTQGSISGLLLAEAFAEAGLPAGVFNTITGRGSEIGDYIVEHQAVNFINFTGS-TGIGERIGKMAGMRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADELVEKIREKVLALTIGNPEDDADITPLIDTKSADYVEGLINDANDKGAAALTEIKREGNLICPILFDKVTTDMRL 373          
BLAST of CX296726 vs. ExPASy Swiss-Prot
Match: GAPN_STREI (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus equinus GN=gapN PE=1 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.222e-68
Identity = 129/241 (53.53%), Postives = 170/241 (70.54%), Query Frame = 1
Query:    4 RTKYCLTSNIPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPAVNCISFTGGD-TGISISKKAGMIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLVMESVADSLXXXXXXXXXXLTVGPPEESCDITPVVSESSANFIEGLVMDAKQKGATFCQEYRREGNLIWPLLLDNVRPDMRI 723
            + K  +    P+G+VLAI PFNYP+NLA SKIAPALI+GN + LKPPTQG+++ L +   F  AG P G+ + +TG+GS IGD++  H AVN I+FTG    G  I   AGM P+ +ELGGKD+ I+LEDADLDL A NI+ G + YSGQRCTAVK VLVM+S+AD L          LTVG PE++ DITP++   +A+++EGL+ DA++KGA     ++REGNLI P+L DNV  DMR+
Sbjct:  133 KKKIAIVRREPVGLVLAISPFNYPINLAGSKIAPALISGNVVALKPPTQGSISGLLLAEAFAEAGLPAGVFNTITGRGSVIGDYIVEHEAVNYINFTGSTPVGEHIGHLAGMRPIMLELGGKDSAIILEDADLDLAAKNIVAGAYGYSGQRCTAVKRVLVMDSIADKLVEKVSALVNNLTVGMPEDNADITPLIDTKAADYVEGLIKDAQEKGAKEVISFKREGNLISPVLFDNVTTDMRL 373          
BLAST of CX296726 vs. ExPASy Swiss-Prot
Match: LADH_METM7 (Lactaldehyde dehydrogenase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_0731 PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 6.769e-35
Identity = 84/232 (36.21%), Postives = 131/232 (56.47%), Query Frame = 1
Query:   22 TSNIPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVAALHMV----HCFHLAGFPKGLISCVTGKGSEIGDFLTMHPAVNCISFTGG-DTGISISKKAGMIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLVMESVADSLXXXXXXXXXXLTVGPP-EESCDITPVVSESSANFIEGLVMDAKQKGATFCQEYRREGNLIWPLLLD 699
            T   PLGVV AI PFN+P+NL   KI PA+  GNS++L P ++  +AA+++     H       P+G+ +  TG G  +GD ++ +  +N +SFTG  + G SISK A M  + +ELGG +  IVL+D+D+ L A + +K  F  +GQ C +V  VLV E V ++           L +G P +   DI P++S  SA  IE L+ ++  +G        R+ +LI+P +++
Sbjct:  125 TKKEPLGVVGAITPFNFPLNLITHKIGPAIATGNSVILHPSSKAPIAAIYLTKIIEHVLKQMDIPRGVFNLATGNGDIVGDEISKNDKINMVSFTGSVEIGESISKNAKMKKVTLELGGNNPMIVLKDSDIKLAAKSAVKSKFLNAGQVCISVGQVLVEEEVLETFTKYIIDETKNLVLGNPLDTKTDIGPLISPESALRIENLIKESVNEGGELLIGGNRQNSLIFPAVIN 356          
The following BLAST results are available for this feature:
BLAST of CX296726 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GAPN_ARATH6.598e-12390.46NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_PEA1.125e-12290.04NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_NICPL3.275e-12288.80NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_APIGR4.728e-12186.72NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_WHEAT1.053e-12087.55NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_MAIZE4.426e-11986.31NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_SCEVA1.214e-9273.33NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_STRMU9.998e-7157.02NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_STREI1.222e-6853.53NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
LADH_METM76.769e-3536.21Lactaldehyde dehydrogenase OS=Methanococcus maripa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05802B04SK FerrChloL1 Citrus clementina cDNA clone C05802B04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296726 ID=CX296726|Name=CX296726|organism=Citrus clementina|type=EST|length=724bp
GAGAGGACTAAATATTGTCTCACTTCAAACATTCCACTTGGTGTGGTTTT
GGCCATTCCACCATTCAACTATCCAGTCAATCTTGCCGTTTCCAAAATTG
CTCCTGCACTGATTGCTGGAAATTCCCTTGTGCTTAAGCCTCCTACTCAG
GGTGCTGTTGCTGCGCTTCACATGGTGCATTGCTTTCACTTGGCTGGTTT
TCCTAAAGGTCTTATAAGCTGTGTCACCGGGAAAGGTTCTGAGATTGGTG
ATTTCCTTACTATGCATCCTGCAGTGAACTGTATAAGCTTCACTGGTGGA
GACACTGGAATTTCAATCTCTAAGAAGGCTGGAATGATCCCTCTTCAGAT
GGAGTTGGGAGGCAAAGATGCTTGTATCGTGCTTGAGGATGCTGACCTTG
ATTTGGTTGCCGCAAACATAATAAAAGGAGGATTTTCTTACAGTGGTCAA
AGATGCACTGCAGTTAAGGTTGTCTTGGTGATGGAATCTGTAGCAGATTC
CCTGGTCGAGAAGGTTAAGGCTAAAGTGGTGAAACTGACAGTTGGCCCTC
CTGAAGAAAGCTGTGATATCACTCCAGTTGTGTCGGAATCATCTGCAAAT
TTCATTGAAGGGCTGGTTATGGATGCCAAACAGAAAGGAGCAACATTCTG
TCAAGAGTACAGGAGAGAAGGCAACCTCATCTGGCCCTTGTTGCTTGACA
ATGTTAGGCCCGATATGAGGATCG
back to top