CX296727

Overview
NameCX296727
Unique NameCX296727
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length383
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig588 contig Ccv1_Contig588:918..1300. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296727 vs. ExPASy Swiss-Prot
Match: RCA1_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Larrea tridentata GN=RCA1 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 7.442e-59
Identity = 108/127 (85.04%), Postives = 112/127 (88.19%), Query Frame = 2
Query:    2 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 382
            LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR DNVADDDIVKLVDTFPGQSIDFFGALRARVY DEVRKW          K LVNSKE  P+FEQP+MT++K
Sbjct:  266 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVADDDIVKLVDTFPGQSIDFFGALRARVYHDEVRKWVSEVGVDTIGKKLVNSKEGPPSFEQPKMTIDK 392          
BLAST of CX296727 vs. ExPASy Swiss-Prot
Match: RCA_MALDO (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Malus domestica GN=RCA PE=2 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 2.165e-58
Identity = 108/127 (85.04%), Postives = 112/127 (88.19%), Query Frame = 2
Query:    2 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 382
            LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVC GIFR+DNVA +DIVKLVDTFPGQSIDFFGALRARVYDDEVRKW          K LVNSKE  PTFEQP+MT+EK
Sbjct:  266 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCIGIFRSDNVAKEDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWITGVGVDSIGKKLVNSKEGPPTFEQPKMTIEK 392          
BLAST of CX296727 vs. ExPASy Swiss-Prot
Match: RCA2_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Larrea tridentata GN=RCA2 PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 1.403e-57
Identity = 105/127 (82.68%), Postives = 111/127 (87.40%), Query Frame = 2
Query:    2 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 382
            LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR DNV ++DIVK+VD FPGQSIDFFGALRARVYDDEVRKW          K LVNSKE  PTFEQP+MT++K
Sbjct:  266 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVPEEDIVKVVDQFPGQSIDFFGALRARVYDDEVRKWVSEVGVDTIGKKLVNSKEGPPTFEQPKMTIDK 392          
BLAST of CX296727 vs. ExPASy Swiss-Prot
Match: RCAB_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase B, chloroplastic OS=Hordeum vulgare GN=RCAB PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.127e-57
Identity = 104/127 (81.89%), Postives = 111/127 (87.40%), Query Frame = 2
Query:    2 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 382
            LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR DNV D+ +V+LVDTFPGQSIDFFGALRARVYDDEVRKW          K LVNS+E  PTF+QP+MT+EK
Sbjct:  253 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVPDEAVVRLVDTFPGQSIDFFGALRARVYDDEVRKWVGEIGVENISKRLVNSREGPPTFDQPKMTIEK 379          
BLAST of CX296727 vs. ExPASy Swiss-Prot
Match: RCA_ORYSJ (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Oryza sativa subsp. japonica GN=RCA PE=1 SV=2)

HSP 1 Score: 218.394 bits (555), Expect = 9.097e-57
Identity = 102/127 (80.31%), Postives = 111/127 (87.40%), Query Frame = 2
Query:    2 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 382
            LPGMYNKE+NPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTR+DR+GVCKGIFR DNV D+DIVK+VD+FPGQSIDFFGALRARVYDDEVRKW          K LVNS+E  P FEQP+MT+EK
Sbjct:  257 LPGMYNKEDNPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTRDDRVGVCKGIFRTDNVPDEDIVKIVDSFPGQSIDFFGALRARVYDDEVRKWVSDTGVENIGKRLVNSREGPPEFEQPKMTIEK 383          
BLAST of CX296727 vs. ExPASy Swiss-Prot
Match: RCA_CUCSA (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 4.515e-56
Identity = 102/127 (80.31%), Postives = 111/127 (87.40%), Query Frame = 2
Query:    2 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 382
            LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRM+KFYWAPTREDRIG+C GIFR D V  +DIVKLVDTFPGQSIDFFGALRARVYDDEVRKW          ++LVNSKE+ PTF+QP+MT+EK
Sbjct:  263 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMDKFYWAPTREDRIGICTGIFRTDGVPFEDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWAVGVGVERIGRNLVNSKESPPTFDQPKMTIEK 389          
BLAST of CX296727 vs. ExPASy Swiss-Prot
Match: RCA_PHAAU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus aureus GN=RCA PE=2 SV=2)

HSP 1 Score: 213.772 bits (543), Expect = 2.241e-55
Identity = 100/127 (78.74%), Postives = 109/127 (85.83%), Query Frame = 2
Query:    2 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 382
            LPGMYNKEEN RVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTR+DR+GVCKGIFR D V ++DI KLVDTFPGQSIDFFGALRARVYDDEVRKW          K LVNSKE  PTF+QP+M+++K
Sbjct:  268 LPGMYNKEENARVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTRDDRVGVCKGIFRTDGVPEEDITKLVDTFPGQSIDFFGALRARVYDDEVRKWISGVGVDATGKKLVNSKEGPPTFDQPKMSLDK 394          
BLAST of CX296727 vs. ExPASy Swiss-Prot
Match: RCA_MAIZE (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Zea mays GN=RCA1 PE=2 SV=3)

HSP 1 Score: 213.386 bits (542), Expect = 2.926e-55
Identity = 100/127 (78.74%), Postives = 110/127 (86.61%), Query Frame = 2
Query:    2 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 382
            LPGMYNKE+NPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR D V ++ +V+LVDTFPGQSIDFFGALRARVYDDEVR+W          + LVNSKE  PTFEQP++T+EK
Sbjct:  262 LPGMYNKEDNPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDGVDEEHVVQLVDTFPGQSIDFFGALRARVYDDEVRRWVSETGVENIARKLVNSKEGPPTFEQPKITIEK 388          
BLAST of CX296727 vs. ExPASy Swiss-Prot
Match: RCAA_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase A, chloroplastic OS=Hordeum vulgare GN=RCAA PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 2.926e-55
Identity = 99/127 (77.95%), Postives = 110/127 (86.61%), Query Frame = 2
Query:    2 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 382
            LPGMYNK ENPRVPI+VTGNDFSTLYAPLIRDGRMEKFYWAPTR+DRIGVCKGIF+ DNV+D+ +VK+VDTFPGQSIDFFGALRARVYDDEVRKW          K LVNS++   TFEQP+MT+EK
Sbjct:  256 LPGMYNKRENPRVPIVVTGNDFSTLYAPLIRDGRMEKFYWAPTRDDRIGVCKGIFQTDNVSDESVVKIVDTFPGQSIDFFGALRARVYDDEVRKWVGSTGIENIGKRLVNSRDGPVTFEQPKMTVEK 382          
BLAST of CX296727 vs. ExPASy Swiss-Prot
Match: RCA_SOLPN (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Solanum pennellii PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.452e-54
Identity = 98/127 (77.17%), Postives = 110/127 (86.61%), Query Frame = 2
Query:    2 LPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 382
            LPGMYNK+EN RVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR DNV ++ +VK+VD+FPGQSIDFFGALRARVYDDEVRKW          + L+NS++  PTFEQP+MT+EK
Sbjct:  265 LPGMYNKQENARVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVPEEAVVKIVDSFPGQSIDFFGALRARVYDDEVRKWVSGTGIELIGEKLLNSRDGPPTFEQPKMTLEK 391          
The following BLAST results are available for this feature:
BLAST of CX296727 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
RCA1_LARTR7.442e-5985.04Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_MALDO2.165e-5885.04Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_LARTR1.403e-5782.68Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAB_HORVU3.127e-5781.89Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ORYSJ9.097e-5780.31Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_CUCSA4.515e-5680.31Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAAU2.241e-5578.74Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_MAIZE2.926e-5578.74Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAA_HORVU2.926e-5577.95Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_SOLPN1.452e-5477.17Ribulose bisphosphate carboxylase/oxygenase activa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05802B05SK FerrChloL1 Citrus clementina cDNA clone C05802B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296727 ID=CX296727|Name=CX296727|organism=Citrus clementina|type=EST|length=383bp
ACTCCCTGGTATGTACAACAAGGAGGAGAACCCCCGTGTCCCAATCATAG
TCACCGGTAATGACTTCTCAACATTGTATGCTCCTCTCATCCGTGATGGT
CGTATGGAGAAATTCTACTGGGCACCTACAAGGGAGGACCGTATTGGTGT
GTGCAAGGGTATCTTCAGGAATGACAATGTGGCTGATGACGACATTGTCA
AGCTTGTCGACACCTTCCCCGGCCAATCCATTGATTTCTTTGGAGCCCTG
AGGGCCAGAGTCTATGATGATGAGGTGAGGAAGTGGATCTCTGGTGTTGG
TGTTGGAAGCATTGGCAAGAGCCTTGTGAACTCAAAGGAAGCAGCCCCAA
CATTCGAGCAACCAAGGATGACAATGGAGAAGC
back to top