CX296728

Overview
NameCX296728
Unique NameCX296728
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length710
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9343 contig Ccv1_Contig9343:36..745. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296728 vs. ExPASy Swiss-Prot
Match: CB2_CHLMO (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Chlamydomonas moewusii PE=2 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 4.882e-30
Identity = 68/156 (43.59%), Postives = 92/156 (58.97%), Query Frame = 3
Query:  249 LLQNRMLETK-KAALQDSSKFKALARQARNESL-WYGEERPRWLGPIPYDYPSYLTGELPGDYGFDVAGLSKDPMAFQKYFNFEILHARWAMLGALGALVPEVLDMVGAFHLVEPVWWRVGYSKLQGETLDYLGIPGLHLAGSQGVIVIAICQALL 710
            L+ NR L  K +AA + +   +  A  A++  + WYG +R +WLGP   + P+YLTGE PGDYG+D AGLS DP  F+KY   E++HARWA+LGALG L PE+L         EPVW++ G        LDYLG P   L  +Q ++     Q +L
Sbjct:    5 LISNRALTVKVEAAKKAAGTKQTKAAPAKSAGIEWYGPDRAKWLGPFSTNTPAYLTGEFPGDYGWDTAGLSADPETFKKYRELEVIHARWALLGALGILTPELLSTYAGVKFGEPVWFKAGAQIFSEGGLDYLGSPA--LIHAQNIVATLAVQVVL 158          
BLAST of CX296728 vs. ExPASy Swiss-Prot
Match: CB21_SILPR (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Silene pratensis PE=2 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 2.051e-28
Identity = 63/125 (50.40%), Postives = 79/125 (63.20%), Query Frame = 3
Query:  336 ESLWYGEERPRWLGPIPYDYPSYLTGELPGDYGFDVAGLSKDPMAFQKYFNFEILHARWAMLGALGALVPEVLDMVGAFHLVEPVWWRVGYSKLQGETLDYLGIPGLHLAGSQGVIVIAICQALL 710
            ES+WYG +RP++LGP     PSYLTGE PGDYG+D AGLS DP  F K    E++H RWAMLGALG + PE+L   G     E VW++ G    Q   LDYLG P  +L  +Q ++ I  CQ +L
Sbjct:   45 ESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGV-KFGEAVWFKAGSQIFQEGGLDYLGNP--NLVHAQSILAIWACQVVL 166          
BLAST of CX296728 vs. ExPASy Swiss-Prot
Match: CB24_SOLLC (Chlorophyll a-b binding protein 4, chloroplastic OS=Solanum lycopersicum GN=CAB4 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.679e-28
Identity = 61/125 (48.80%), Postives = 79/125 (63.20%), Query Frame = 3
Query:  336 ESLWYGEERPRWLGPIPYDYPSYLTGELPGDYGFDVAGLSKDPMAFQKYFNFEILHARWAMLGALGALVPEVLDMVGAFHLVEPVWWRVGYSKLQGETLDYLGIPGLHLAGSQGVIVIAICQALL 710
            +S+WYGE+RP++LGP     PSYLTGE PGDYG+D AGLS DP  F +    E++H RWAMLGALG + PE+L   G     E VW++ G        LDYLG P  +L  +Q ++ I  CQ +L
Sbjct:   46 QSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGV-KFGEAVWFKAGSQIFSEGGLDYLGNP--NLVHAQSILAIWACQVVL 167          
BLAST of CX296728 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.794e-28
Identity = 64/134 (47.76%), Postives = 82/134 (61.19%), Query Frame = 3
Query:  309 KALARQARNESLWYGEERPRWLGPIPYDYPSYLTGELPGDYGFDVAGLSKDPMAFQKYFNFEILHARWAMLGALGALVPEVLDMVGAFHLVEPVWWRVGYSKLQGETLDYLGIPGLHLAGSQGVIVIAICQALL 710
            KA+A+ A + S WYG +R ++LGP   + PSYLTGE PGDYG+D AGLS DP  F K    E++H RWAMLGALG + PE+L   G     E VW++ G        LDYLG P   L  +Q ++ I  CQ +L
Sbjct:   37 KAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGV-KFGEAVWFKAGSQIFSEGGLDYLGNPS--LVHAQSILAIWACQVVL 167          
BLAST of CX296728 vs. ExPASy Swiss-Prot
Match: CB21_WHEAT (Chlorophyll a-b binding protein, chloroplastic OS=Triticum aestivum GN=WHAB1.6 PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.018e-27
Identity = 70/166 (42.17%), Postives = 92/166 (55.42%), Query Frame = 3
Query:  213 AVKAIANSPLGELLQNRMLETKKAALQDSSKFKALARQARNESLWYGEERPRWLGPIPYDYPSYLTGELPGDYGFDVAGLSKDPMAFQKYFNFEILHARWAMLGALGALVPEVLDMVGAFHLVEPVWWRVGYSKLQGETLDYLGIPGLHLAGSQGVIVIAICQALL 710
            A KA+ N P   L+ +  +  +K A        A A+Q  + S WYG +R  +LGP+  + PSYLTGE PGDYG+D AGLS DP  F K    E++H RWAMLGALG + PE+L   G     E  W++ G        LDYLG P   L  +Q ++ I  CQ +L
Sbjct:   14 AGKAVKNLPSSALIGDARVNMRKTA--------AKAKQVSSSSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGV-KFGEAGWFKAGSQIFSDGGLDYLGNPS--LVHAQSLLAIWACQVVL 168          
BLAST of CX296728 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 1.329e-27
Identity = 61/124 (49.19%), Postives = 77/124 (62.10%), Query Frame = 3
Query:  339 SLWYGEERPRWLGPIPYDYPSYLTGELPGDYGFDVAGLSKDPMAFQKYFNFEILHARWAMLGALGALVPEVLDMVGAFHLVEPVWWRVGYSKLQGETLDYLGIPGLHLAGSQGVIVIAICQALL 710
            S+WYG +RP++LGP     PSYLTGE PGDYG+D AGLS DP  F K    E++H RWAMLGALG + PE+L   G     E VW++ G        LDYLG P  +L  +Q ++ I  CQ +L
Sbjct:   47 SIWYGPDRPKYLGPFSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGV-KFGEAVWFKAGSQIFSEGGLDYLGNP--NLIHAQSILAIWACQVVL 167          
BLAST of CX296728 vs. ExPASy Swiss-Prot
Match: CB2_PHYPA (Chlorophyll a-b binding protein, chloroplastic OS=Physcomitrella patens PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.268e-27
Identity = 60/134 (44.78%), Postives = 83/134 (61.94%), Query Frame = 3
Query:  309 KALARQARNESLWYGEERPRWLGPIPYDYPSYLTGELPGDYGFDVAGLSKDPMAFQKYFNFEILHARWAMLGALGALVPEVLDMVGAFHLVEPVWWRVGYSKLQGETLDYLGIPGLHLAGSQGVIVIAICQALL 710
            + +++ A ++++WYG +RP++LGP   + PSYL GE  GDYG+D AGLS DP  F +    E++HARWAMLGALG L PE+L   G     E VW++ G        LDYLG P   L  +Q ++ I  CQ +L
Sbjct:   40 RTVSKSAGSDTIWYGADRPKFLGPFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAKSGV-KFGEAVWFKAGAQIFSEGGLDYLGNPS--LVHAQSILAIWACQVVL 170          
BLAST of CX296728 vs. ExPASy Swiss-Prot
Match: CB26_PETSP (Chlorophyll a-b binding protein 37, chloroplastic OS=Petunia sp. GN=CAB37 PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 5.052e-27
Identity = 60/125 (48.00%), Postives = 78/125 (62.40%), Query Frame = 3
Query:  336 ESLWYGEERPRWLGPIPYDYPSYLTGELPGDYGFDVAGLSKDPMAFQKYFNFEILHARWAMLGALGALVPEVLDMVGAFHLVEPVWWRVGYSKLQGETLDYLGIPGLHLAGSQGVIVIAICQALL 710
            +S+WYGE+RP++LGP     PSYLTGE PGDYG+D AGLS DP  F +    E++H RWAMLGALG + PE+L   G     E VW++ G        LDYLG P  +L  +Q ++ I   Q +L
Sbjct:   46 QSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGV-TFGEAVWFKAGSQIFSEGGLDYLGNP--NLIHAQSILAIWAAQVVL 167          
BLAST of CX296728 vs. ExPASy Swiss-Prot
Match: CB23_SOLLC (Chlorophyll a-b binding protein 13, chloroplastic OS=Solanum lycopersicum GN=CAB13 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 5.052e-27
Identity = 61/131 (46.56%), Postives = 78/131 (59.54%), Query Frame = 3
Query:  318 ARQARNESLWYGEERPRWLGPIPYDYPSYLTGELPGDYGFDVAGLSKDPMAFQKYFNFEILHARWAMLGALGALVPEVLDMVGAFHLVEPVWWRVGYSKLQGETLDYLGIPGLHLAGSQGVIVIAICQALL 710
            AR   +  LWYG +R ++LGP     PSYL GE PGDYG+D AGLS DP AF K    E++H RWAMLGALG + PEVL+        EPVW++ G        LDYLG P  +L  +Q ++ +   Q +L
Sbjct:   38 ARFTMSNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCIFPEVLEKWVKVDFKEPVWFKAGSQIFSDGGLDYLGNP--NLVHAQSILAVLGFQVVL 166          
BLAST of CX296728 vs. ExPASy Swiss-Prot
Match: CB23_POLMU (Chlorophyll a-b binding protein type 1 member F3, chloroplastic OS=Polystichum munitum GN=CABF3 PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 5.052e-27
Identity = 69/168 (41.07%), Postives = 95/168 (56.55%), Query Frame = 3
Query:  210 TAVKAIANSPLGELLQN-RMLETKKAALQDSSKFKALARQARNESLWYGEERPRWLGPIPYDYPSYLTGELPGDYGFDVAGLSKDPMAFQKYFNFEILHARWAMLGALGALVPEVLDMVGAFHLVEPVWWRVGYSKLQGETLDYLGIPGLHLAGSQGVIVIAICQALL 710
            T+  A+ ++  G+ L+    L  K  A +   +  A   +A + S+WYG +RP +LGP     PSYL+GE PGDYG+D AGLS DP  F K    E++H+RWAMLGALG + PE+L   G     E VW++ G        LDYLG P   L  +Q ++ I  CQ +L
Sbjct:    3 TSTAALTSTFSGQQLKPVNELSRKVGAGEARVQMMAPKSKAPSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVTPELLAKNGV-KFGEAVWFKAGSQIFAEGGLDYLGNPS--LVHAQSILAIWACQVIL 167          
The following BLAST results are available for this feature:
BLAST of CX296728 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
CB2_CHLMO4.882e-3043.59Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB21_SILPR2.051e-2850.40Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB24_SOLLC2.679e-2848.80Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB2B_SOLLC7.794e-2847.76Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB21_WHEAT1.018e-2742.17Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB21_GOSHI1.329e-2749.19Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB2_PHYPA2.268e-2744.78Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB26_PETSP5.052e-2748.00Chlorophyll a-b binding protein 37, chloroplastic ... [more]
CB23_SOLLC5.052e-2746.56Chlorophyll a-b binding protein 13, chloroplastic ... [more]
CB23_POLMU5.052e-2741.07Chlorophyll a-b binding protein type 1 member F3, ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05802B06SK FerrChloL1 Citrus clementina cDNA clone C05802B06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296728 ID=CX296728|Name=CX296728|organism=Citrus clementina|type=EST|length=710bp
CCGAATTCGGCACGAGGCAGGCGCATGCCACGGAGGATTGGCTTTCATGG
AGTTGTTGTTCGAGCTGGAGTGGAGGATGCTCGCTCAGGAAGATTTTAGC
CCTGAAACCTTCACGAAAGAATCTTCTCCTTAAACCCAAGTCTTCTTTAG
TCTGCAAAGCATCGTGGCAAGAGCTTGCGGGAGTGTTAGTATTCTCGGCA
ATACCCTTCACGGCTGTGAAAGCCATCGCAAATAGCCCTCTCGGAGAATT
GCTCCAAAACAGAATGTTGGAGACCAAGAAAGCTGCTCTCCAAGACTCTT
CCAAGTTCAAAGCCTTGGCTCGTCAAGCACGAAATGAAAGCTTGTGGTAT
GGAGAAGAGAGGCCTCGATGGCTTGGTCCCATTCCGTATGACTATCCTTC
ATATCTTACCGGAGAGCTACCTGGGGATTATGGCTTTGATGTTGCTGGTC
TGAGCAAGGATCCTATGGCTTTCCAGAAATACTTCAACTTTGAAATACTT
CATGCTCGTTGGGCCATGCTTGGAGCCCTTGGTGCCCTAGTTCCAGAAGT
TTTAGATATGGTAGGAGCCTTCCACTTGGTTGAGCCTGTCTGGTGGCGTG
TTGGATACTCAAAGCTCCAGGGAGAGACCCTGGACTACCTTGGTATCCCA
GGTCTCCATTTAGCTGGAAGCCAAGGAGTAATTGTCATTGCTATTTGCCA
AGCCCTCCTG
back to top