CX296730

Overview
NameCX296730
Unique NameCX296730
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length618
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig708 contig Ccv1_Contig708:1..618. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296730 vs. ExPASy Swiss-Prot
Match: PABP2_ARATH (Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.312e-43
Identity = 96/167 (57.49%), Postives = 114/167 (68.26%), Query Frame = 3
Query:  117 AMIPPQPGFGYQQQLVPGMRPGGGPMQNFFVPIXXXXXXXXXXXXXXXXXMQQNQQHVPMMQPQMLPRGRVYRYPSGRGMPDVSMPGVGGMLPIPYGDMAAMPLRDAPISQPVPIGALASALANASPEQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLH 617
            AMIPPQPG+GYQQQLVPGMRPGGGP+ +FF+P+                 +Q +QQ  PMMQ QM PRGR++RYP GRG       G G + P   G+           + P+ IGALAS L+NA+PEQQRTMLGE LYPLVEQ+E ++AAKVTGMLLEMDQTEVLH
Sbjct:  445 AMIPPQPGYGYQQQLVPGMRPGGGPVPSFFMPMVQPQQQRPGGGRRPGG-IQHSQQQNPMMQQQMHPRGRMFRYPQGRG-------GSGDVPPYDMGN-----------NMPLTIGALASNLSNATPEQQRTMLGEVLYPLVEQVEAESAAKVTGMLLEMDQTEVLH 592          
BLAST of CX296730 vs. ExPASy Swiss-Prot
Match: PABP3_ARATH (Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.970e-23
Identity = 72/174 (41.38%), Postives = 95/174 (54.60%), Query Frame = 3
Query:  117 AMIPPQP-GFGYQQQLVPGMRPGGGPMQNFFVPIXXXXXXXXXXXXXXXXXMQQNQQHVPMMQPQMLPRGRVYRY----PSGRGMPDVSMPG--VGGMLPIPYGDMAAMPLRDAPISQPVPIGALASALANASPEQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLH 617
            +M+P QP G+G+Q Q +PGMRPG GP  NF VP                      QQH+   Q          RY     +GR   D S+P   +  ++P+P  D +++  + AP+   +PI  L S+LA+ASP  +  MLGE LYPLVE+ EP   AKVTGMLLEMDQ E+LH
Sbjct:  456 SMVPSQPIGYGFQPQFMPGMRPGSGP-GNFIVPYPLQRQPQTGPRMGFRRGATNVQQHIQQQQLMHRNPSPGMRYMNGASNGRNGMDSSVPQGILPPIIPLPI-DASSISHQKAPL---LPISKLTSSLASASPADRTRMLGEQLYPLVERHEPLHVAKVTGMLLEMDQAEILH 624          
BLAST of CX296730 vs. ExPASy Swiss-Prot
Match: PABP5_ARATH (Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 2.178e-22
Identity = 70/171 (40.94%), Postives = 87/171 (50.88%), Query Frame = 3
Query:  120 MIPPQP-GFGYQQQLVPGMRPGGGPMQNFFVPIXXXXXXXXXXXXXXXXXMQQNQQHVPMMQPQMLPRGRVYRYPSGRGMPDVSMPGVG--GMLPIPYGDMAAMPLRDAPISQPVP--IGALASALANASPEQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLH 617
            ++P QP G+GYQ Q +PGMRPG GP  NF +P                      QQ     Q Q + +    R+  G G     M      G++P+P    A          +P P  I  LAS LA ASP++   MLG++LYPLVEQ EP  AAKVTGMLLEMDQ E+LH
Sbjct:  461 LVPSQPMGYGYQVQFMPGMRPGAGP-PNFMMPFPLQRQTQPGPRVGFRRGANNMQQQ---FQQQQMLQQNASRFMGGAGNRRNGMEASAPQGIIPLPLNASANSHNAPQRSHKPTPLTISKLASDLALASPDKHPRMLGDHLYPLVEQQEPANAAKVTGMLLEMDQAEILH 627          
BLAST of CX296730 vs. ExPASy Swiss-Prot
Match: PABP_EMENI (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans GN=pab1 PE=2 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 1.512e-15
Identity = 67/187 (35.83%), Postives = 86/187 (45.99%), Query Frame = 3
Query:  120 MIPPQPGFGYQQQLVPGMRPGGGPMQNFFVPIXXXXXXXXXXXXXXXXXMQQNQQHVPM--MQPQMLPRGRVY-----RYPSGRGMPDVSMPGVGGMLPIPYGD-MAAMPL----------RDAPISQP---VPIGAL-ASALANASPEQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVL 614
            M PPQPG        PG  PG  P Q                       +  N Q +PM  MQ   +P G  Y     ++  GRG   V  PG+GG +   YG     +PL          R   + QP    P+G L A AL+ A P+QQ+ MLGE LYP ++  +P+ A K+TGMLLEMD TE+L
Sbjct:  510 MFPPQPGMMMGMPGRPGQYPGPFPGQQ------------GGRGVGPNQQIPPNFQGLPMGAMQGPGIPNGMGYPMVQGQFGGGRGRGQV--PGMGGPMRGGYGGGRGGVPLGGQMRPGQGGRGQAVGQPGPETPVGVLTAQALSAAPPQQQKQMLGEALYPKIQATQPELAGKITGMLLEMDNTELL 682          
BLAST of CX296730 vs. ExPASy Swiss-Prot
Match: PABP_CRYNE (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans GN=PAB1 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.672e-14
Identity = 63/186 (33.87%), Postives = 83/186 (44.62%), Query Frame = 3
Query:  126 PPQPGFGYQQQLVPGMRPGGGPMQNFFVPIXXXXXXXXXXXXXXXXXMQQNQQHVP-----MMQPQMLPRGRVYRYPSGRG------MPDVSMPGVGGMLPI------PYGDM---AAMPLRDAPISQPVP-IGAL-ASALANASPEQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLH 617
            PP PG+G   Q +PGM P  GPM  +                        N Q +P        P  +P      YP   G       P+ + P  GG  P+      P G +     MP R    + P P  G L A +LA A+P +Q+ MLGE LYPL+ + +P+ A K+TGMLLEMD  E+LH
Sbjct:  448 PPMPGYG---QPMPGMPPVRGPMMGY--------PGAPQNMMQSRPRFNPNGQPLPGGVPAYGMPPQVPYPGAPGYPVRPGGARIPAAPNANGPRNGGPSPVGAPQGLPAGSIPRGGQMPARPHEQAAPAPQAGRLDAQSLARAAPAEQKQMLGEALYPLIHETQPELAGKITGMLLEMDNAELLH 622          
BLAST of CX296730 vs. ExPASy Swiss-Prot
Match: PABP_ASPCL (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus GN=pab1 PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.565e-12
Identity = 49/106 (46.23%), Postives = 61/106 (57.55%), Query Frame = 3
Query:  318 RGRVYRYPSGRGMPDVSMPGVGGML--PIPYG----DMAAMPLRDAPISQPVPIGAL-ASALANASPEQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVL 614
            RG+V   P G+GM      G GG    P P G    + AA P   A   +  P GAL A AL  A+P QQ+ MLGE LYP ++  +P+ A K+TGMLLEMD TE+L
Sbjct:  599 RGQVPGMPMGQGMRGPGYQGRGGPQGGPRPQGGRGQNAAAQP---AAGREEAPAGALTAQALNAAAPPQQKQMLGEALYPKIQAQQPELAGKITGMLLEMDNTELL 701          
BLAST of CX296730 vs. ExPASy Swiss-Prot
Match: PABP_PHANO (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum GN=PAB1 PE=3 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 2.951e-11
Identity = 55/165 (33.33%), Postives = 73/165 (44.24%), Query Frame = 3
Query:  162 VPGMRPG-GGPMQNFFVPIXXXXXXXXXXXXXXXXXMQQNQQHVPMMQPQMLPRG-RVYRYPSGRGMPDVSM---PGV-GGMLPIPYGDMAAMPLRDAPISQPVPIGALA-------SALANASPEQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLH 617
            +PG + G GGP      P+                  QQ  Q     Q  M  RG R    P   GMP   +   PG+ GG    P G   A   R  P     P G          S L+ A+P QQ+ MLGE LYP + +++P+ A K+TGMLLEMD +E+++
Sbjct:  536 MPGQQGGRGGPNAQQMPPMYMPPGMAPGAFPPGPYMNQQYMQLAQAAQQAMGGRGGRGGPMPGMPGMPQAQIAGGPGIRGGQGGFPQGGRGAPGGRGQPPMPGFPQGGRPGGPGVDMSVLSAAAPGQQKQMLGEALYPKIHEMQPELAGKITGMLLEMDNSELIN 700          
BLAST of CX296730 vs. ExPASy Swiss-Prot
Match: PABP_ASPOR (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae GN=pab1 PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.951e-11
Identity = 64/194 (32.99%), Postives = 84/194 (43.30%), Query Frame = 3
Query:  126 PPQPGFGYQQQLVPGMRPGGGPMQNFFVPIXXXXXXXXXXXXXXXXXMQQNQQHVPM--MQ---------PQMLPRGRVYRYPSGRG----MPDVSM----PGVG---GMLPIPYGDMA------AMPLRDAPISQP---VPIGALASALANASPEQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVL 614
            PPQPG       +PG RPG  P                         +  N Q +PM  MQ         PQ + + +  R   GRG    MP++      PG G   G +P+  G M             AP  +P   V  G  A AL+ A P QQ+ MLGE LYP ++  +P+ A K+TGMLLEM+ TE+L
Sbjct:  528 PPQPGMVMAG--IPGGRPGQYP--------GPFPGQQGGRGMGPNQQLPPNFQGIPMGAMQGPVPNGMGYPQGMAQVQFGRGAGGRGQVPGMPNMGQGMRGPGYGQGRGGVPVQQGQMRPGQGGRGQNAAQAPAGRPEEAVAGGLTAQALSAAPPPQQKQMLGEALYPKIQAQQPELAGKITGMLLEMENTELL 711          
BLAST of CX296730 vs. ExPASy Swiss-Prot
Match: PABP_USTMA (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis GN=PAB1 PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.573e-11
Identity = 59/189 (31.22%), Postives = 79/189 (41.80%), Query Frame = 3
Query:  129 PQPGFGYQQQLVPGMRPGGGPMQNFFVPIXXXXXXXXXXXXXXXXXMQQNQQHVPMMQPQMLPRGRVYRYPSG-------RGMPDVS-----------MPGVGGMLPIPYGD-MAAMPLRDAPISQPV-------PIGALASALANASPEQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLH 617
            P PG  Y Q      +PGG   +  + P                  M Q     P  QP   P G +   P G       RG P+ +             GV G  P P G  +   P+   P ++P        P    A+ALA ASPE+Q+ MLGE +YP V   +P+ A K+TGM+LE+  TE+LH
Sbjct:  439 PGPGMYYPQPGAFPGQPGGMVPRPRYAPAGM---------------MPQGMPMAPYGQPGQFPAGMM---PQGYRPARPPRGAPNAAGGPAPPAGARPPTGVNGA-PRPAGQPVPGQPMPRGPAARPAGRPEADQPGALTAAALAKASPEEQKQMLGEAIYPKVAASQPELAGKLTGMILELPVTELLH 608          
The following BLAST results are available for this feature:
BLAST of CX296730 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
PABP2_ARATH1.312e-4357.49Polyadenylate-binding protein 2 OS=Arabidopsis tha... [more]
PABP3_ARATH1.970e-2341.38Polyadenylate-binding protein 3 OS=Arabidopsis tha... [more]
PABP5_ARATH2.178e-2240.94Polyadenylate-binding protein 5 OS=Arabidopsis tha... [more]
PABP_EMENI1.512e-1535.83Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_CRYNE1.672e-1433.87Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_ASPCL1.565e-1246.23Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_PHANO2.951e-1133.33Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_ASPOR2.951e-1132.99Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_USTMA6.573e-1131.22Polyadenylate-binding protein, cytoplasmic and nuc... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05802B08SK FerrChloL1 Citrus clementina cDNA clone C05802B08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296730 ID=CX296730|Name=CX296730|organism=Citrus clementina|type=EST|length=618bp
GAGGCCTCGTGCCGAATTCGGCACGAGGGGCTTCTACAGTCGCTCCTCGA
ATGCCGATGTACCCTCCTGGTGGTCCAGGTATTGGGCAACAAATATTCTA
TGGTCAAGGCCCGCCTGCTATGATTCCTCCTCAGCCTGGATTTGGTTATC
AGCAGCAGCTTGTTCCTGGTATGAGGCCAGGTGGGGGTCCCATGCAAAAT
TTCTTTGTGCCGATAGCTCAGCCAGGGCAGCAGGGTCAGCGTCCTAGTGG
CAGACGGGCAGCAGGCATGCAGCAGAACCAGCAGCATGTTCCAATGATGC
AGCCACAGATGCTTCCAAGGGGGCGTGTCTACCGCTACCCGTCAGGCCGT
GGCATGCCAGATGTTTCCATGCCTGGTGTCGGAGGGATGCTACCTATTCC
ATATGGTGACATGGCTGCTATGCCGCTGCGTGATGCCCCTATTTCACAGC
CAGTTCCCATTGGGGCTTTGGCTTCTGCCCTTGCAAATGCTTCTCCTGAG
CAGCAGAGGACGATGCTGGGAGAGAATCTCTACCCACTTGTAGAACAGCT
GGAGCCTGATGCTGCAGCTAAGGTTACGGGAATGCTTTTGGAGATGGATC
AGACTGAGGTTTTGCACT
back to top