CX296731

Overview
NameCX296731
Unique NameCX296731
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9765 contig Ccv1_Contig9765:296..984. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296731 vs. ExPASy Swiss-Prot
Match: CB4A_SOLLC (Chlorophyll a-b binding protein CP24 10A, chloroplastic OS=Solanum lycopersicum GN=CAP10A PE=3 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 3.950e-98
Identity = 165/180 (91.67%), Postives = 176/180 (97.78%), Query Frame = 1
Query:    7 LAGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAGQGKTP 546
            L GSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAV+GIFVGQAWSGIPWFEAGADPGAIAPFSFG+LLGTQL+LMGWVESKRWVDFF+P+SQSVEWATPWS+TAENFAN TGEQGYPGGKFFDPL LAGT+ +GVY+PDTEKL+RLKVAEIKHARLAM+AMLIFYFEAGQGKTP
Sbjct:   71 LDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGTLLGTQLILMGWVESKRWVDFFDPDSQSVEWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLERLKVAEIKHARLAMLAMLIFYFEAGQGKTP 250          
BLAST of CX296731 vs. ExPASy Swiss-Prot
Match: CB4B_SOLLC (Chlorophyll a-b binding protein CP24 10B, chloroplastic OS=Solanum lycopersicum GN=CAP10B PE=3 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 4.829e-96
Identity = 161/180 (89.44%), Postives = 175/180 (97.22%), Query Frame = 1
Query:    7 LAGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAGQGKTP 546
            L GSLPGD+GFDPLGLGKDPAFLKWYREAELIHGRWAMAAV+GIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAENFAN TGEQGYPGGKFFDPL LAGT+ +GVY+PDTEKL+RLK+AEIKH+RLAM+AMLIFYFEAGQGKTP
Sbjct:   71 LDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLERLKLAEIKHSRLAMLAMLIFYFEAGQGKTP 250          
BLAST of CX296731 vs. ExPASy Swiss-Prot
Match: CB4_SPIOL (Chlorophyll a-b binding protein CP24, chloroplastic OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 6.306e-96
Identity = 161/180 (89.44%), Postives = 175/180 (97.22%), Query Frame = 1
Query:    7 LAGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAGQGKTP 546
            L GSLPGD+GFDPLGLGKDPAFLKWYREAELIHGRWAM AV+GIFVGQAW+GIPWFEAGADPGA+APFSFG+LLGTQLLLMGWVESKRWVDFF+P+SQSVEWATPWSRTAENF+N+TGEQGYPGGKFFDPL LAGTI +GVY PDT+KL+RLK+AEIKHARLAM+AMLIFYFEAGQGKTP
Sbjct:   76 LDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMLAVLGIFVGQAWTGIPWFEAGADPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFDPDSQSVEWATPWSRTAENFSNSTGEQGYPGGKFFDPLSLAGTISNGVYNPDTDKLERLKLAEIKHARLAMLAMLIFYFEAGQGKTP 255          
BLAST of CX296731 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 5.824e-25
Identity = 67/179 (37.43%), Postives = 93/179 (51.96%), Query Frame = 1
Query:    7 LAGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFE 525
            L GSLPGD+GFDPLGLG DP  LKW  +AEL+H RWAM    GIF+ +  + I       W+ AG            +L   +L+L+GW E +RW D   P   + +   P ++          + GYPGG +FDPL        G       K+  L+  EIK+ RLAM+A++  +F+
Sbjct:   78 LDGSLPGDFGFDPLGLGSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFT---DTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT------DVGYPGGLWFDPL--------GWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQ 239          
BLAST of CX296731 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 6.439e-24
Identity = 65/179 (36.31%), Postives = 93/179 (51.96%), Query Frame = 1
Query:    7 LAGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFE 525
            L GSLPGD+GFDPLGL  DP  L+W ++AEL+H RWAM    GIF+ +  + I       W+ AG            +L   +L+L+GW E +RW D   P   + +   P ++          + GYPGG +FDPL        G       K+  L+  EIK+ RLAM+A++  +F+
Sbjct:   78 LDGSLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFT---DTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT------DVGYPGGLWFDPL--------GWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQ 239          
BLAST of CX296731 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.991e-21
Identity = 68/187 (36.36%), Postives = 97/187 (51.87%), Query Frame = 1
Query:    7 LAGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAG-QGKTP 546
            L GSLPGD GFDPLGL +DP  L+W+ +AEL++GRWAM  V G+ + + ++ I       W+ AG +       S  +L   + +L  +VE +RW D  NP S + +         + ++   GE GYPGG  F+PL  A T++              K  EI + RLAM+A L F  +    GK P
Sbjct:   66 LTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFA---SSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQD------PIFKQYSLPAGEVGYPGG-IFNPLNFAPTLE-------------AKEKEIANGRLAMLAFLGFIIQHNVTGKGP 229          
BLAST of CX296731 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.137e-20
Identity = 79/232 (34.05%), Postives = 104/232 (44.83%), Query Frame = 1
Query:    7 LAGSLPGDYGFDPLGLGKDPAFLKW-------------------------------------------YREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAG--------ADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFE-AGQGKTP 546
            L GSL GDYGFDP GLGK   +L++                                           +RE ELIHGRWAM A +G    +  +G+ W +AG        +  G   PFS  +L+  ++L++G++E +R     N E  S                   ++ YPGGKFFDPL LA          D EK  +L++AEIKHARLAMVA L F  + A  GK P
Sbjct:   68 LDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAADAKSTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQR-----NAELDS------------------EKRLYPGGKFFDPLGLAA---------DPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP 267          
BLAST of CX296731 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.319e-20
Identity = 67/187 (35.83%), Postives = 95/187 (50.80%), Query Frame = 1
Query:    7 LAGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAG-QGKTP 546
            L GSL GD GFDPLGL +DP  LKW+ +AEL++GRWAM  V G+ + + ++ I       W++AG +       S  +L   + +L  +VE +RW D  NP S + +         + ++   GE GYPGG  F+PL  A T                K  E+ + RLAM+A L F  +    GK P
Sbjct:   67 LTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGIINVPEWYDAGKEQYFA---SSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQD------PIFKQYSLPKGEVGYPGG-IFNPLNFAPT-------------QEAKEKELANGRLAMLAFLGFVVQHNVTGKGP 230          
BLAST of CX296731 vs. ExPASy Swiss-Prot
Match: CB4C_ARATH (Chlorophyll a-b binding protein CP29.3, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.3 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.641e-20
Identity = 78/232 (33.62%), Postives = 103/232 (44.40%), Query Frame = 1
Query:    7 LAGSLPGDYGFDPLGLGKDPAFLKW-------------------------------------------YREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADP--------GAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAG-QGKTP 546
            L GS+ GD GFDP GLGK   +L++                                           +RE ELIHGRWAM   +G    +A +GI W +AG           G   PFS  +L+  ++L++G++E +R  +  +PE +                       YPGG +FDPL LA          D EKLD LK+AEIKH+RLAMVA LIF  +A   GK P
Sbjct:   69 LDGSMIGDRGFDPFGLGKPAEYLQYDFDGLDQNLAKNVAGDIIGIIQESSEIKPTPFQPYTEVFGIQRFRECELIHGRWAMLGTLGAIAVEALTGIAWQDAGKVELVEGSSYLGQPLPFSLTTLIWIEVLVVGYIEFQRNSEL-DPEKRI----------------------YPGG-YFDPLGLAA---------DPEKLDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGP 267          
BLAST of CX296731 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.641e-19
Identity = 77/232 (33.19%), Postives = 102/232 (43.97%), Query Frame = 1
Query:    7 LAGSLPGDYGFDPLGLGKDPAFLKW-------------------------------------------YREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAG--------ADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFE-AGQGKTP 546
            L GSL GDYGFDP GLGK   +L++                                           +RE ELIHGRWAM A +G    +  +G+ W +AG        +  G   PFS  +L+  ++L++G++E +R     N E  S                   ++ YPGGKFFDPL LA          D  K  +L++AEIKHARLAMV  L F  + A  GK P
Sbjct:   65 LDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLYGEVIGTRTEAVDPKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGAITVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQR-----NAELDS------------------EKRLYPGGKFFDPLGLAS---------DPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGP 264          
The following BLAST results are available for this feature:
BLAST of CX296731 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 69
Match NameE-valueIdentityDescription
CB4A_SOLLC3.950e-9891.67Chlorophyll a-b binding protein CP24 10A, chloropl... [more]
CB4B_SOLLC4.829e-9689.44Chlorophyll a-b binding protein CP24 10B, chloropl... [more]
CB4_SPIOL6.306e-9689.44Chlorophyll a-b binding protein CP24, chloroplasti... [more]
CB12_PETHY5.824e-2537.43Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB12_SOLLC6.439e-2436.31Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB24_PEA2.991e-2136.36Chlorophyll a-b binding protein P4, chloroplastic ... [more]
CB4A_ARATH1.137e-2034.05Chlorophyll a-b binding protein CP29.1, chloroplas... [more]
CB24_ARATH4.319e-2035.83Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB4C_ARATH5.641e-2033.62Chlorophyll a-b binding protein CP29.3, chloroplas... [more]
CB4B_ARATH1.641e-1933.19Chlorophyll a-b binding protein CP29.2, chloroplas... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05802B09SK FerrChloL1 Citrus clementina cDNA clone C05802B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296731 ID=CX296731|Name=CX296731|organism=Citrus clementina|type=EST|length=689bp
CGAGGGCTCGCTGGCTCTCTCCCAGGTGACTACGGATTCGACCCACTTGG
GCTTGGAAAGGACCCAGCATTCCTGAAATGGTACAGAGAAGCAGAACTGA
TCCACGGACGATGGGCAATGGCTGCAGTTGTTGGGATATTCGTCGGACAG
GCGTGGAGTGGGATTCCATGGTTCGAGGCTGGAGCAGATCCTGGAGCCAT
AGCACCCTTCTCCTTCGGCTCACTCCTGGGAACCCAGCTTCTCCTTATGG
GTTGGGTTGAGAGCAAGCGGTGGGTTGATTTTTTCAATCCTGAATCTCAA
TCAGTTGAATGGGCAACACCTTGGTCAAGAACTGCTGAAAACTTTGCCAA
TGCGACTGGTGAACAAGGCTACCCTGGTGGAAAGTTTTTTGATCCCTTAT
GTTTGGCTGGAACAATTAAGGATGGTGTCTACATTCCTGACACTGAGAAG
CTTGACAGGCTCAAAGTTGCTGAGATTAAACATGCTAGGCTTGCTATGGT
GGCCATGTTGATTTTCTACTTTGAAGCTGGCCAAGGCAAGACGCCACTTG
GGGCTCTTGGTTTGTAAAACATGCTTATGTAGATAACTCACTGATTGGTG
TTAAAGCGTAATCAATCGGATGTATACCTCGTGCCGAATTCGGCACGAGG
CCTCGTGCCGAATTCGGCACGAAGGGGGGGCCCGGTACC
back to top