CX296736

Overview
NameCX296736
Unique NameCX296736
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length749
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX296736 vs. ExPASy Swiss-Prot
Match: RCA_MALDO (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Malus domestica GN=RCA PE=2 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 5.791e-93
Identity = 167/210 (79.52%), Postives = 185/210 (88.10%), Query Frame = 1
Query:  103 PLSFNGSGAATSVPSSSFFGTSLKKVSSRIPPSKVPSASFKITAEVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGKCAA 732
            P + NGS ++ SVPSS+F G+SLKKV+SR   SKV S S +I A VDE+KQT +DRWKGLA+D SDDQQDITRGKG VDSLFQAP G+GTH+A+MSSY+YIS GLR YN DN +DG YIAPAFMDKLVVHITKNFM+LPN+KVPLILGIWGGKGQGKSFQCELVFAKM I+PIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGK  A
Sbjct:   15 PPNLNGSSSSASVPSSTFLGSSLKKVNSRFTNSKVSSGSLRIVASVDEDKQTDKDRWKGLAFDTSDDQQDITRGKGKVDSLFQAPQGSGTHFAIMSSYEYISTGLRQYNFDNNMDGYYIAPAFMDKLVVHITKNFMTLPNMKVPLILGIWGGKGQGKSFQCELVFAKMRISPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGKMCA 224          
BLAST of CX296736 vs. ExPASy Swiss-Prot
Match: RCA1_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Larrea tridentata GN=RCA1 PE=2 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.137e-92
Identity = 170/209 (81.34%), Postives = 188/209 (89.95%), Query Frame = 1
Query:  103 PLSFNGSGAATS-VPSSSFFGTSLKKVSSRIPPSKVPSASFKITA-EVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGK 723
            PLS NGSGA  S VPS++FFG+SLKK +++ P  K  S +FKI A E+ E++QT +D+WKGLAYD SDDQQDITRGKG VD+LFQAPM +GTHYAVMSSYDYISQGLR YNLDN +DG YIAPAFMDKLVVHITKNF+SLPNIK+PLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADII+KGK
Sbjct:   15 PLSLNGSGARASLVPSTAFFGSSLKKSAAKFP--KASSGNFKIVAQEISEDQQTDKDKWKGLAYDISDDQQDITRGKGMVDTLFQAPMQSGTHYAVMSSYDYISQGLRQYNLDNNMDGFYIAPAFMDKLVVHITKNFLSLPNIKIPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIKKGK 221          

HSP 2 Score: 21.557 bits (44), Expect = 1.137e-92
Identity = 7/10 (70.00%), Postives = 9/10 (90.00%), Query Frame = 3
Query:  711 QEGKMCCLMI 740
            ++GKMCCL I
Sbjct:  218 KKGKMCCLFI 227          
BLAST of CX296736 vs. ExPASy Swiss-Prot
Match: RCA2_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Larrea tridentata GN=RCA2 PE=2 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.138e-92
Identity = 170/209 (81.34%), Postives = 188/209 (89.95%), Query Frame = 1
Query:  103 PLSFNGSGAATS-VPSSSFFGTSLKKVSSRIPPSKVPSASFKITA-EVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGK 723
            PLS NGSGA  S VPS++FFG+SLKK +++ P  K  S +FKI A E+ E++QT +D+WKGLAYD SDDQQDITRGKG VD+LFQAPM +GTHYAVMSSYDYISQGLR YNLDN +DG YIAPAFMDKLVVHITKNF+SLPNIK+PLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADII+KGK
Sbjct:   15 PLSLNGSGARASLVPSTAFFGSSLKKSAAKFP--KASSGNFKIVAQEISEDQQTDKDKWKGLAYDISDDQQDITRGKGMVDTLFQAPMQSGTHYAVMSSYDYISQGLRQYNLDNNMDGFYIAPAFMDKLVVHITKNFLSLPNIKIPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIKKGK 221          

HSP 2 Score: 21.557 bits (44), Expect = 1.138e-92
Identity = 7/10 (70.00%), Postives = 9/10 (90.00%), Query Frame = 3
Query:  711 QEGKMCCLMI 740
            ++GKMCCL I
Sbjct:  218 KKGKMCCLFI 227          
BLAST of CX296736 vs. ExPASy Swiss-Prot
Match: RCA_PHAAU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus aureus GN=RCA PE=2 SV=2)

HSP 1 Score: 331.257 bits (848), Expect = 3.513e-90
Identity = 169/213 (79.34%), Postives = 185/213 (86.85%), Query Frame = 1
Query:  106 LSFNGSGAATSVPSSSFFGTSLKK-VSSRIPPSKVPSASFKITA---EVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGKCAA 732
            L+ NGSGA  S P+S+FFGTSLKK V+SR+P SKV + SFKI A   E++E++QT +DRWKGLAYD SDDQQDITRGKG VD LFQAPM  GTHYAVMSSY+Y+S GLR   LDN  DG YIAPAF+DKLVVHITKNFM+LPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAAD+I KGK  A
Sbjct:   16 LNLNGSGAGASAPTSAFFGTSLKKAVASRVPNSKVTNGSFKIVAAEKEIEESQQTNKDRWKGLAYDISDDQQDITRGKGMVDPLFQAPMDAGTHYAVMSSYEYLSTGLR--QLDNIKDGFYIAPAFLDKLVVHITKNFMTLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADLIAKGKMCA 226          
BLAST of CX296736 vs. ExPASy Swiss-Prot
Match: RCA_PHAVU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus vulgaris GN=RCA1 PE=2 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 4.588e-90
Identity = 165/210 (78.57%), Postives = 183/210 (87.14%), Query Frame = 1
Query:  106 LSFNGSGAATSVPSSSFFGTSLKKV-SSRIPPSKVPSASFKITA---EVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGK 723
            L+ NGSG   S PSS+FFGTSLKKV SSR+P SK+ S SFKI A   E++E +QT+ DRW+GLAYD SDDQQDITRGKG VDSLFQAPM  GTHYAV+SS+ Y+S GLR YN DN  DG YIAPAF+DKLVVHI KNFM+LPNIKVPLILG+WGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREA+D+I+KGK
Sbjct:   16 LNLNGSGGGASGPSSAFFGTSLKKVISSRVPNSKLTSGSFKIVAADKEIEETQQTEGDRWRGLAYDVSDDQQDITRGKGLVDSLFQAPMDAGTHYAVISSHKYLSAGLRQYNFDNIKDGFYIAPAFLDKLVVHIAKNFMTLPNIKVPLILGVWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREASDLIKKGK 225          
BLAST of CX296736 vs. ExPASy Swiss-Prot
Match: RCA_ARATH (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Arabidopsis thaliana GN=RCA PE=1 SV=2)

HSP 1 Score: 322.783 bits (826), Expect = 6.154e-88
Identity = 166/222 (74.77%), Postives = 185/222 (83.33%), Query Frame = 1
Query:   88 MAAAV---------PLSFNGSGA-ATSVPSSSFFGTSLKKVSSRIPPSKVPSASFKITAEVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGK 723
            MAAAV         PLS NGSG+ A S P+S+F G  +  VS     +K  + SFK+ A V E+KQT  DRW+GLAYD SDDQQDITRGKG VDS+FQAPMGTGTH+AV+SSY+Y+SQGLR YNLDN +DG YIAPAFMDKLVVHITKNF++LPNIKVPLILGIWGGKGQGKSFQCELV AKMGINPIMMSAGELESGNAGEPAKLIRQRYREAAD+I+KGK
Sbjct:    1 MAAAVSTVGAINRAPLSLNGSGSGAVSAPASTFLGKKVVTVSRFAQSNKKSNGSFKVLA-VKEDKQTDGDRWRGLAYDTSDDQQDITRGKGMVDSVFQAPMGTGTHHAVLSSYEYVSQGLRQYNLDNMMDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGIWGGKGQGKSFQCELVMAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADLIKKGK 221          

HSP 2 Score: 21.557 bits (44), Expect = 6.154e-88
Identity = 7/10 (70.00%), Postives = 9/10 (90.00%), Query Frame = 3
Query:  711 QEGKMCCLMI 740
            ++GKMCCL I
Sbjct:  218 KKGKMCCLFI 227          
BLAST of CX296736 vs. ExPASy Swiss-Prot
Match: RCA1_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 1.632e-87
Identity = 163/210 (77.62%), Postives = 177/210 (84.29%), Query Frame = 1
Query:  103 PLSFNGSGAATSVPSSSFFGTSLKKVSSR-IPPSKVPSASFKITAE---VDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKG 720
            PLS N S A TSVPS++FFG +LKKV  + +   KV + S +I AE   VD  KQT  DRWKGL  D SDDQQDITRGKG VDSLFQAP GTGTH+AV+ SY+Y+SQGLR YNLDN +DG YIAPAFMDKLVVHITKNF+ LPNIKVPLILGIWGGKGQGKSFQCELVF KMGINPIMMSAGELESGNAGEPAKLIRQRYREAA+IIRKG
Sbjct:   15 PLSLNNSVAGTSVPSTAFFGKTLKKVYGKGVSSPKVTNKSLRIVAEQIDVDPKKQTDSDRWKGLVQDFSDDQQDITRGKGMVDSLFQAPTGTGTHHAVLQSYEYVSQGLRQYNLDNKLDGFYIAPAFMDKLVVHITKNFLKLPNIKVPLILGIWGGKGQGKSFQCELVFRKMGINPIMMSAGELESGNAGEPAKLIRQRYREAAEIIRKG 224          
BLAST of CX296736 vs. ExPASy Swiss-Prot
Match: RCA2_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Nicotiana tabacum GN=RCA PE=2 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 1.804e-86
Identity = 160/214 (74.77%), Postives = 177/214 (82.71%), Query Frame = 1
Query:   91 AAAVPLSFNGSGAATSVPSSSFFGTSLKKVSSR-IPPSKVPSASFKITAE---VDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKG 720
            A   PLS N S A TSVPS++FFG +LKKV  + +   KV + S +I AE    D  KQT  DRWKGL  D SDDQQDI RGKG VDSLFQAP GTGTH+AV+ SY+Y+SQGLR YN+DNT+DG YIAP+FMDKLVVHITKNF+ LPNIKVPLILG+WGGKGQGKSFQCELVF KMGINPIMMSAGELESGNAGEPAKLIRQRYREAA+IIRKG
Sbjct:   11 ANKAPLSLNNSVAGTSVPSTAFFGKTLKKVYGKGVSSPKVTNRSLRIAAEEKDADPKKQTYSDRWKGLVQDFSDDQQDIARGKGMVDSLFQAPTGTGTHHAVLQSYEYVSQGLRQYNMDNTLDGFYIAPSFMDKLVVHITKNFLKLPNIKVPLILGVWGGKGQGKSFQCELVFRKMGINPIMMSAGELESGNAGEPAKLIRQRYREAAEIIRKG 224          
BLAST of CX296736 vs. ExPASy Swiss-Prot
Match: RCA_CUCSA (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 3.319e-86
Identity = 157/214 (73.36%), Postives = 178/214 (83.18%), Query Frame = 1
Query:   82 SLMAAAVPLSFNGSGAATSVPSSSFFGTSLKKVSSRIPPSKVPSASFKITAEVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGK 723
            S + A    + N S     VP+S+F G+ LK VSSR   SK+ + +FKI AE DE KQT++D+W+GLA+D SDDQQDITRGKG  D LFQAPMGTGTH AV+SSY+YIS GLR Y+ DN +DG YIAPAFMDKL VHI KNF++LPNIKVPLILG+WGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADII+KGK
Sbjct:    6 STIGAVNRTTLNNSNYGGLVPNSAFLGSRLK-VSSRFTTSKMVTGNFKIVAEQDEEKQTEKDKWRGLAFDTSDDQQDITRGKGLADPLFQAPMGTGTHNAVLSSYEYISAGLRDYSYDNNVDGFYIAPAFMDKLTVHIVKNFLTLPNIKVPLILGVWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIKKGK 218          

HSP 2 Score: 21.557 bits (44), Expect = 3.319e-86
Identity = 7/10 (70.00%), Postives = 9/10 (90.00%), Query Frame = 3
Query:  711 QEGKMCCLMI 740
            ++GKMCCL I
Sbjct:  215 KKGKMCCLFI 224          
BLAST of CX296736 vs. ExPASy Swiss-Prot
Match: RCA_SOLPN (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Solanum pennellii PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 5.804e-85
Identity = 158/212 (74.53%), Postives = 181/212 (85.38%), Query Frame = 1
Query:   91 AAAVPLSFNGSGAATSVPSSSFFGTSLKKVSSR-IPPSKVPSASFKITA-EVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKG 720
            A+  PLS N S A TSVPS++FFG SLKKV ++ +   KV + + ++ A EVDE   TK+DRWKGL  + SDDQQDI RGKG VDSLFQAP GTGTH+A+M+SY+Y+SQ L+TY LDN +DG YIAPAFMDKLVVHITKNF++LPNIKVPLILG+WGGKGQGKSFQCELVF KMGINPIMMSAGELESGNAGEPAKLIRQRYREAA+IIRKG
Sbjct:   11 ASKAPLSLNNSVAGTSVPSTAFFGKSLKKVYAKGVSSPKVSNRNLRVVAQEVDE---TKEDRWKGLYDNTSDDQQDIARGKGLVDSLFQAPTGTGTHHAIMNSYEYVSQALKTYQLDNKLDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGVWGGKGQGKSFQCELVFRKMGINPIMMSAGELESGNAGEPAKLIRQRYREAAEIIRKG 219          
The following BLAST results are available for this feature:
BLAST of CX296736 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
RCA_MALDO5.791e-9379.52Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA1_LARTR1.137e-9281.34Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_LARTR1.138e-9281.34Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAAU3.513e-9079.34Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAVU4.588e-9078.57Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ARATH6.154e-8874.77Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA1_TOBAC1.632e-8777.62Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_TOBAC1.804e-8674.77Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_CUCSA3.319e-8673.36Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_SOLPN5.804e-8574.53Ribulose bisphosphate carboxylase/oxygenase activa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05802C02SK FerrChloL1 Citrus clementina cDNA clone C05802C02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296736 ID=CX296736; Name=CX296736; organism=Citrus clementina; type=EST; length=749bp
GAGGGCATTCCTTCGCTTTCCTTTGCCTGCATTACAGCGCGACCCTTTAG
CTACTTCAATCACAGCCGTCCAATTCTCGCTAGCCTAATGGCTGCTGCTG
TACCGTTGAGCTTCAATGGCTCTGGTGCTGCAACCTCTGTCCCAAGCTCA
TCTTTCTTTGGCACCAGCTTGAAGAAGGTAAGCTCAAGGATCCCCCCATC
CAAGGTCCCTTCTGCGAGCTTCAAGATTACTGCTGAAGTCGATGAGAACA
AGCAGACCAAGCAGGACAGATGGAAGGGCCTTGCCTACGACGAATCTGAT
GACCAACAAGACATCACCAGAGGAAAAGGTGCTGTGGACTCTCTGTTCCA
AGCCCCCATGGGAACCGGAACTCACTATGCTGTCATGAGTTCTTATGACT
ACATCAGCCAAGGTCTCCGCACATACAACTTGGACAACACGATCGACGGT
CTCTACATTGCCCCTGCTTTCATGGACAAGCTTGTTGTTCACATCACCAA
GAACTTCATGTCCCTGCCCAACATCAAGGTTCCTCTCATCTTGGGTATTT
GGGGAGGCAAAGGACAAGGAAAATCATTCCAATGTGAGCTTGTTTTCGCC
AAGATGGGCATCAACCCAATTATGATGAGTGCCGGAGAATTGGAAAGTGG
CAATGCTGGAGAACCCGCTAAGTTGATCAGGCAGAGGTACCGTGAGGCAG
CTGACATTATCAGGAAGGGAAAATGTGCTGCCTCATGATCATGATCTTG
back to top