CX296737

Overview
NameCX296737
Unique NameCX296737
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length661
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig789 contig Ccv1_Contig789:376..1036. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296737 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 444.121 bits (1141), Expect = 2.932e-124
Identity = 214/219 (97.72%), Postives = 217/219 (99.09%), Query Frame = 3
Query:    3 YAWVLDKLTAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLT 659
            YAWVLDKL AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLT
Sbjct:   56 YAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLT 274          
BLAST of CX296737 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 1.114e-123
Identity = 212/219 (96.80%), Postives = 217/219 (99.09%), Query Frame = 3
Query:    3 YAWVLDKLTAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLT 659
            YAWVLDKL AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLT
Sbjct:   56 YAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLT 274          
BLAST of CX296737 vs. ExPASy Swiss-Prot
Match: EF1A_WHEAT (Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 2.482e-123
Identity = 212/219 (96.80%), Postives = 217/219 (99.09%), Query Frame = 3
Query:    3 YAWVLDKLTAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLT 659
            YAWVLDKL AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EIVKEVSSYLKKVGYNP+KVPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLT
Sbjct:   56 YAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLT 274          
BLAST of CX296737 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 440.269 bits (1131), Expect = 4.234e-123
Identity = 211/219 (96.35%), Postives = 216/219 (98.63%), Query Frame = 3
Query:    3 YAWVLDKLTAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLT 659
            YAWVLDKL AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLT
Sbjct:   56 YAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIQEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLT 274          
BLAST of CX296737 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 439.113 bits (1128), Expect = 9.433e-123
Identity = 211/219 (96.35%), Postives = 216/219 (98.63%), Query Frame = 3
Query:    3 YAWVLDKLTAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLT 659
            YAWVLDKL AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALL+FTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLDALD I+EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLT
Sbjct:   56 YAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLT 274          
BLAST of CX296737 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 1.232e-122
Identity = 211/219 (96.35%), Postives = 216/219 (98.63%), Query Frame = 3
Query:    3 YAWVLDKLTAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLT 659
            YAWVLDKL AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD IN+ KRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLT
Sbjct:   56 YAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINDAKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLT 274          
BLAST of CX296737 vs. ExPASy Swiss-Prot
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 1.609e-122
Identity = 209/219 (95.43%), Postives = 216/219 (98.63%), Query Frame = 3
Query:    3 YAWVLDKLTAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLT 659
            YAWVLDKL AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLT
Sbjct:   56 YAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLT 274          
BLAST of CX296737 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 437.573 bits (1124), Expect = 2.745e-122
Identity = 211/219 (96.35%), Postives = 216/219 (98.63%), Query Frame = 3
Query:    3 YAWVLDKLTAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLT 659
            YAWVLDKL AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+ FVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLT
Sbjct:   56 YAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLT 274          
BLAST of CX296737 vs. ExPASy Swiss-Prot
Match: EF1A1_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 437.573 bits (1124), Expect = 2.745e-122
Identity = 211/219 (96.35%), Postives = 213/219 (97.26%), Query Frame = 3
Query:    3 YAWVLDKLTAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLT 659
            YAWVLDKL AERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIID TTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEK+ FVPISGFEGDNMIERSTNLDWYKGPTLLDALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG +KPGMVVTFGPSGLT
Sbjct:   56 YAWVLDKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDPTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKIAFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTIKPGMVVTFGPSGLT 274          
BLAST of CX296737 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 435.261 bits (1118), Expect = 1.362e-121
Identity = 208/219 (94.98%), Postives = 215/219 (98.17%), Query Frame = 3
Query:    3 YAWVLDKLTAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLT 659
            YAWVLDKL AERERGITIDIALWKFET+KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RY+EIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIG VPVGRVETGV+KPGM+VTF P+GLT
Sbjct:   56 YAWVLDKLKAERERGITIDIALWKFETSKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGIVPVGRVETGVVKPGMLVTFAPTGLT 274          
The following BLAST results are available for this feature:
BLAST of CX296737 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_ORYSJ2.932e-12497.72Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_SOLLC1.114e-12396.80Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_WHEAT2.482e-12396.80Elongation factor 1-alpha OS=Triticum aestivum GN=... [more]
EF1A_MANES4.234e-12396.35Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A_SOYBN9.433e-12396.35Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_TOBAC1.232e-12296.35Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_ARATH1.609e-12295.43Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]
EF1A_MAIZE2.745e-12296.35Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A1_DAUCA2.745e-12296.35Elongation factor 1-alpha OS=Daucus carota PE=3 SV... [more]
EF1A_VICFA1.362e-12194.98Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05802C03SK FerrChloL1 Citrus clementina cDNA clone C05802C03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296737 ID=CX296737|Name=CX296737|organism=Citrus clementina|type=EST|length=661bp
AGTACGCCTGGGTGCTCGACAAGCTCACGGCTGAGCGTGAACGTGGTATT
ACCATTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCAC
CGTCATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCG
GTACCTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGT
GGTTTTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTT
GCTTGCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGA
TGGACGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTG
AAGGAGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGT
CCCATTCGTGCCCATCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGT
CTACCAACCTTGACTGGTACAAGGGTCCAACCCTGCTGGACGCTCTTGAC
AATATCAATGAGCCAAAGAGGCCCTCAGACAAGCCCCTTCGTCTGCCACT
CCAGGACGTGTACAAGATTGGTGGCATTGGAACCGTCCCAGTGGGTCGCG
TTGAGACCGGTGTCCTCAAGCCTGGTATGGTGGTGACATTTGGCCCCTCT
GGATTGACAAC
back to top