CX296740

Overview
NameCX296740
Unique NameCX296740
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length757
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig928 contig Ccv1_Contig928:282..1039. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296740 vs. ExPASy Swiss-Prot
Match: RS3A1_VITVI (40S ribosomal protein S3a-1 OS=Vitis vinifera GN=GSVIVT00020038001 PE=3 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 3.619e-79
Identity = 139/165 (84.24%), Postives = 148/165 (89.70%), Query Frame = -3
Query:  198 LTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMREIMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKMERPADEPIPEAPTEVIGA 692
            LTNFWGMDFTTDKLRSLVRKW TLIEA+VDVKTTDNYTLR+FCI FTK+  NQ K+TCYAQ+SQIRQIRRKMREIM   A SCDLK LV+KFI E IGREIEKAT SIYPLQNV+IRKVKILKAPKFDLGKLMEVHGDYSEDVG K+ERPADEP+ E  TEVIGA
Sbjct:   97 LTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKKRVNQNKKTCYAQSSQIRQIRRKMREIMTNMATSCDLKELVKKFIPESIGREIEKATSSIYPLQNVYIRKVKILKAPKFDLGKLMEVHGDYSEDVGTKLERPADEPVAEGVTEVIGA 261          

HSP 2 Score: 34.2686 bits (77), Expect = 3.619e-79
Identity = 15/16 (93.75%), Postives = 16/16 (100.00%), Query Frame = -1
Query:  692 YRKIRLRAEDVQGKNV 739
            YRKIRLRAEDVQG+NV
Sbjct:   81 YRKIRLRAEDVQGRNV 96          
BLAST of CX296740 vs. ExPASy Swiss-Prot
Match: RS3A_CICAR (40S ribosomal protein S3a OS=Cicer arietinum PE=2 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 6.156e-79
Identity = 138/165 (83.64%), Postives = 149/165 (90.30%), Query Frame = -3
Query:  198 LTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMREIMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKMERPADEPIPEAPTEVIGA 692
            LTNF+GMDFTTDKLRSLVRKW TLIEA+VDVKTTDNYTLRMFCIGFTKR  NQVKRTCYAQ+SQIRQIRRKMREIM+ QA SCDLK LV KFI E+IG+EIEKAT SIYPLQNVFIRKVKILK+PKFDLGKLMEVHGDYSEDVG K+E PADE + E   E++GA
Sbjct:   97 LTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQIRQIRRKMREIMVNQATSCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKSPKFDLGKLMEVHGDYSEDVGTKVESPADETVVEGTPEIVGA 261          

HSP 2 Score: 33.8834 bits (76), Expect = 6.156e-79
Identity = 15/16 (93.75%), Postives = 16/16 (100.00%), Query Frame = -1
Query:  692 YRKIRLRAEDVQGKNV 739
            +RKIRLRAEDVQGKNV
Sbjct:   81 FRKIRLRAEDVQGKNV 96          
BLAST of CX296740 vs. ExPASy Swiss-Prot
Match: RS3A_HELAN (40S ribosomal protein S3a OS=Helianthus annuus GN=RPS3A PE=2 SV=2)

HSP 1 Score: 278.87 bits (712), Expect = 6.156e-79
Identity = 138/165 (83.64%), Postives = 152/165 (92.12%), Query Frame = -3
Query:  198 LTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMREIMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKMERPADEPIPEAPTEVIGA 692
            LTNFWGMD TTDKLRSLV+KW +LIEA+VDVKTTDN+TLRMFCIGFTK+  NQVKRTCYAQ+SQI+QIRRKMREIM+ QA +CDLK LV+KFI E IGREIEKAT SIYPLQNVFIRKVKILKAPKFD+GKLMEVHGDYSEDVGVK++RPA+E  PEA TEVIGA
Sbjct:   97 LTNFWGMDVTTDKLRSLVKKWQSLIEAHVDVKTTDNFTLRMFCIGFTKKRANQVKRTCYAQSSQIKQIRRKMREIMVTQAQTCDLKELVQKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDIGKLMEVHGDYSEDVGVKLDRPAEEAAPEA-TEVIGA 260          

HSP 2 Score: 35.4242 bits (80), Expect = 6.156e-79
Identity = 16/16 (100.00%), Postives = 16/16 (100.00%), Query Frame = -1
Query:  692 YRKIRLRAEDVQGKNV 739
            YRKIRLRAEDVQGKNV
Sbjct:   81 YRKIRLRAEDVQGKNV 96          
BLAST of CX296740 vs. ExPASy Swiss-Prot
Match: RS3A2_ARATH (40S ribosomal protein S3a-2 OS=Arabidopsis thaliana GN=RPS3AB PE=2 SV=3)

HSP 1 Score: 274.248 bits (700), Expect = 3.311e-77
Identity = 137/166 (82.53%), Postives = 148/166 (89.16%), Query Frame = -3
Query:  198 LTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMREIMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDY-SEDVGVKMERPADEPIPEAPTEVIGA 692
            LT FWGMDFTTDKLRSLV+KW TLIEA+VDVKTTD YTLRMFCI FTKR  NQVKRTCYAQ+SQIRQIRRKM EIM+ +A+SCDLK LV KFI E IGREIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLMEVHGDY +EDVGVK++RPADE + E PTE+IGA
Sbjct:   97 LTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRMFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETMVEEPTEIIGA 262          

HSP 2 Score: 34.2686 bits (77), Expect = 3.311e-77
Identity = 15/16 (93.75%), Postives = 16/16 (100.00%), Query Frame = -1
Query:  692 YRKIRLRAEDVQGKNV 739
            YRKIRLRAEDVQG+NV
Sbjct:   81 YRKIRLRAEDVQGRNV 96          
BLAST of CX296740 vs. ExPASy Swiss-Prot
Match: RS3A_CATRO (40S ribosomal protein S3a OS=Catharanthus roseus GN=RPS3A PE=2 SV=4)

HSP 1 Score: 274.633 bits (701), Expect = 4.318e-77
Identity = 138/166 (83.13%), Postives = 151/166 (90.96%), Query Frame = -3
Query:  198 LTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMREIMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYSE-DVGVKMERPADEPIPEAPTEVIGA 692
            LTNFWGMDFTTDKLRSLVRKW +LIEA+VDVKTTD+YTLRMFCIGFTK+  NQ KRTCYAQ+SQIRQIRRKMREIM+ QA SCDLK LV+KFI E IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDY+E D+G K++RPA+E + E PTEVIGA
Sbjct:   97 LTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRANQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVQKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYNEDDIGTKLDRPAEEAVAE-PTEVIGA 261          

HSP 2 Score: 33.4982 bits (75), Expect = 4.318e-77
Identity = 14/16 (87.50%), Postives = 16/16 (100.00%), Query Frame = -1
Query:  692 YRKIRLRAEDVQGKNV 739
            +RKIRLRAED+QGKNV
Sbjct:   81 FRKIRLRAEDIQGKNV 96          
BLAST of CX296740 vs. ExPASy Swiss-Prot
Match: RS3A_DAUCA (40S ribosomal protein S3a OS=Daucus carota GN=cyc07 PE=2 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 1.250e-76
Identity = 136/165 (82.42%), Postives = 148/165 (89.70%), Query Frame = -3
Query:  198 LTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMREIMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKMERPADEPIPEAPTEVIGA 692
            LTNF+GMDFTTDKLRSLVRKW TLIEA+VDVKTTD+YTLRMFCIGFTK+  NQ KRTCYAQ+SQIRQIRRKM EIM  QA+SCDLK LV KFI E IGREIEKAT SI+PLQNVFIRKVKILKAPKFD+GKLMEVHGDYSEDVGVK+ERP +E + E  TEV+GA
Sbjct:   97 LTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKKRANQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVFIRKVKILKAPKFDIGKLMEVHGDYSEDVGVKLERPIEETMVEGETEVVGA 261          

HSP 2 Score: 35.4242 bits (80), Expect = 1.250e-76
Identity = 16/16 (100.00%), Postives = 16/16 (100.00%), Query Frame = -1
Query:  692 YRKIRLRAEDVQGKNV 739
            YRKIRLRAEDVQGKNV
Sbjct:   81 YRKIRLRAEDVQGKNV 96          
BLAST of CX296740 vs. ExPASy Swiss-Prot
Match: RS3A1_ARATH (40S ribosomal protein S3a-1 OS=Arabidopsis thaliana GN=RPS3AA PE=1 SV=3)

HSP 1 Score: 271.552 bits (693), Expect = 2.126e-76
Identity = 135/166 (81.33%), Postives = 148/166 (89.16%), Query Frame = -3
Query:  198 LTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMREIMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYS-EDVGVKMERPADEPIPEAPTEVIGA 692
            L  FWGMDFTTDKLRSLV+KW TLIEA+VDVKTTD+YTLR+FCI FTKR  NQVKRTCYAQ+SQIRQIRRKMR+IM+ +A+SCDLK LV KFI E IGREIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLM+VHGDYS EDVGVK++RPADE   E PTE+IGA
Sbjct:   97 LCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRDIMVREASSCDLKDLVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMDVHGDYSAEDVGVKVDRPADEMAVEEPTEIIGA 262          

HSP 2 Score: 34.2686 bits (77), Expect = 2.126e-76
Identity = 15/16 (93.75%), Postives = 16/16 (100.00%), Query Frame = -1
Query:  692 YRKIRLRAEDVQGKNV 739
            YRKIRLRAEDVQG+NV
Sbjct:   81 YRKIRLRAEDVQGRNV 96          
BLAST of CX296740 vs. ExPASy Swiss-Prot
Match: RS3A_BRARA (40S ribosomal protein S3a OS=Brassica rapa GN=RPS3A PE=2 SV=2)

HSP 1 Score: 260.766 bits (665), Expect = 3.609e-73
Identity = 134/167 (80.24%), Postives = 148/167 (88.62%), Query Frame = -3
Query:  198 LTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMREIMI-AQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDY-SEDVGVKMERPADEPIPEAPTEVIGA 692
            LT FWGMDFTTDKLRSLV+KW TLIE++VDVKTTDNYTLR+FCI FTKR  NQVKRTCYAQ+SQIRQIR KMREIMI  +A+SCDLK LV KFI E IG++IEKAT  IYPLQNVFIRKVKILKAPKFDL KLMEVHGDY +EDVGVK++RPADE + E PTE+IGA
Sbjct:   97 LTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMREIMIKEEASSCDLKELVAKFIPESIGKDIEKATQGIYPLQNVFIRKVKILKAPKFDLRKLMEVHGDYTAEDVGVKVDRPADE-VVEEPTEIIGA 262          

HSP 2 Score: 34.2686 bits (77), Expect = 3.609e-73
Identity = 15/16 (93.75%), Postives = 16/16 (100.00%), Query Frame = -1
Query:  692 YRKIRLRAEDVQGKNV 739
            YRKIRLRAEDVQG+NV
Sbjct:   81 YRKIRLRAEDVQGRNV 96          
BLAST of CX296740 vs. ExPASy Swiss-Prot
Match: RS3A_TOBAC (40S ribosomal protein S3a OS=Nicotiana tabacum GN=cyc07 PE=2 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 5.172e-73
Identity = 141/189 (74.60%), Postives = 158/189 (83.60%), Query Frame = -3
Query:  198 LQEDQTKS*RCPR--------EECLTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMREIMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKMERPADEPIPEAPTEVIGA 740
            LQ+D+ +S R  R        +  LTNFWGMDFTTDKLRSLV+KW TLIEA+VDVKTTD+YTLRMFCI FTK+ PNQ KRTCYAQ+SQIRQIRRKM EIM  QA+SCDLK LV KFI E IGREIEKAT SI+PLQNV+IRKVKILKAPKFD+GKLMEVHGDYSEDVGVK++RPADE + EA  E+ GA
Sbjct:   73 LQKDEDQSFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDIGKLMEVHGDYSEDVGVKLDRPADETVAEAEPEIPGA 261          
BLAST of CX296740 vs. ExPASy Swiss-Prot
Match: RS3A_ORYSJ (40S ribosomal protein S3a OS=Oryza sativa subsp. japonica GN=RPS3A PE=2 SV=2)

HSP 1 Score: 258.07 bits (658), Expect = 1.044e-72
Identity = 126/154 (81.82%), Postives = 140/154 (90.91%), Query Frame = -3
Query:  234 LTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMREIMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYS-EDVGVKMERPADE 692
            LTNFWGM FTTDKLRSLV+KW TLIEA+VDVKTTD Y LR+FCIGFTKR PNQVKRTCYAQASQIRQIRRKM EIM  QA+SCDLK LV KFI E+IG+EIEKAT SI+PLQNVF+RKVKILKAPKFDLGKLMEVHGDY+ ED+G K++RPA++
Sbjct:   97 LTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDGYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEIMANQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLMEVHGDYAKEDIGTKLDRPAED 250          

HSP 2 Score: 35.4242 bits (80), Expect = 1.044e-72
Identity = 16/16 (100.00%), Postives = 16/16 (100.00%), Query Frame = -1
Query:  692 YRKIRLRAEDVQGKNV 739
            YRKIRLRAEDVQGKNV
Sbjct:   81 YRKIRLRAEDVQGKNV 96          
The following BLAST results are available for this feature:
BLAST of CX296740 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 166
Match NameE-valueIdentityDescription
RS3A1_VITVI3.619e-7984.2440S ribosomal protein S3a-1 OS=Vitis vinifera GN=G... [more]
RS3A_CICAR6.156e-7983.6440S ribosomal protein S3a OS=Cicer arietinum PE=2 ... [more]
RS3A_HELAN6.156e-7983.6440S ribosomal protein S3a OS=Helianthus annuus GN=... [more]
RS3A2_ARATH3.311e-7782.5340S ribosomal protein S3a-2 OS=Arabidopsis thalian... [more]
RS3A_CATRO4.318e-7783.1340S ribosomal protein S3a OS=Catharanthus roseus G... [more]
RS3A_DAUCA1.250e-7682.4240S ribosomal protein S3a OS=Daucus carota GN=cyc0... [more]
RS3A1_ARATH2.126e-7681.3340S ribosomal protein S3a-1 OS=Arabidopsis thalian... [more]
RS3A_BRARA3.609e-7380.2440S ribosomal protein S3a OS=Brassica rapa GN=RPS3... [more]
RS3A_TOBAC5.172e-7374.6040S ribosomal protein S3a OS=Nicotiana tabacum GN=... [more]
RS3A_ORYSJ1.044e-7281.8240S ribosomal protein S3a OS=Oryza sativa subsp. j... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05802C06SK FerrChloL1 Citrus clementina cDNA clone C05802C06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296740 ID=CX296740|Name=CX296740|organism=Citrus clementina|type=EST|length=757bp
CCGAATTCGGCACGAGGCTGGAATAAAGAATAAGGTAATCATGTTCATAC
CACAGAAACCGCTGCAGCCATCTCAAATATCAGCTAGAATAAAATATGTA
AACTCAAAACAAATTTGAGTTCATCACAAACAAAACTGCCCAAAAATTAC
TAGATCTGATTGGTTATAAAGACAAACTACAAAAATTTCTTTATTCAAGC
TCCAATCACTTCAGTTGGTGCTTCAGGAATGGGCTCATCAGCTGGCCTTT
CCATCTTTACACCAACATCCTCAGAGTAATCACCATGAACCTCCATCAAC
TTTCCAAGATCAAACTTAGGAGCTTTCAAGATCTTCACTTTGCGAATGAA
AACATTTTGTAAGGGGTATATGCTTAAGGTTGCCTTCTCAATCTCTCTTC
CAATTATTTCAGCAATGAACTTTTCGACCAAGCCCTTAAGATCACAGGAT
GCTGCCTGAGCAATCATGATCTCCCTCATCTTGCGGCGAATCTGTCTAAT
CTGGCTGGCCTGTGCGTAGCAAGTCCTCTTAACCTGATTTGGAAGTCTCT
TGGTGAATCCAATGCAGAACATCCTCAATGTGTAGTTATCAGTGGTCTTG
ACATCCACGTAAGCTTCAATCAACGTATGCCACTTCCTAACCAAGGACCT
CAGCTTGTCTGTAGTGAAATCCATGCCCCAGAAGTTTGTCAAACATTCTT
CCCTTGGACATCTTCAGCTCTTAGTCTGATCTTCCTGTAGCATGCTCTTC
TTCATAT
back to top