CX296749

Overview
NameCX296749
Unique NameCX296749
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length277
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX296749 vs. ExPASy Swiss-Prot
Match: PUB35_ARATH (U-box domain-containing protein 35 OS=Arabidopsis thaliana GN=PUB35 PE=1 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 4.365e-27
Identity = 57/87 (65.52%), Postives = 74/87 (85.06%), Query Frame = 3
Query:   18 VYAYGMVILQLLTAKPAIAITHKVETAIDE-DNLAEILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLKEVAD 275
            +Y++GM++LQLLTAKPAIA+TH VE+A+D  D   +ILD +AG+WPI+ET+ELAAL L C ELR KDRPDLK+Q+LP LE LK+VA+
Sbjct:  667 IYSFGMILLQLLTAKPAIALTHFVESAMDSNDEFLKILDQKAGNWPIEETRELAALALCCTELRGKDRPDLKDQILPALENLKKVAE 753          
BLAST of CX296749 vs. ExPASy Swiss-Prot
Match: PUB52_ARATH (U-box domain-containing protein 52 OS=Arabidopsis thaliana GN=PUB52 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 5.701e-27
Identity = 58/87 (66.67%), Postives = 72/87 (82.76%), Query Frame = 3
Query:   18 VYAYGMVILQLLTAKPAIAITHKVETAIDED-NLAEILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLKEVAD 275
            VY+ G+VILQL+TAKPAIAITH VE AI +D     ILD +AG WPI +T+ELAALGL C E+RR+DRPDLK+Q++P LERL++VAD
Sbjct:  676 VYSLGVVILQLITAKPAIAITHMVEEAIGDDAEFMAILDKKAGSWPISDTRELAALGLCCTEMRRRDRPDLKDQIIPALERLRKVAD 762          
BLAST of CX296749 vs. ExPASy Swiss-Prot
Match: PUB53_ARATH (Putative U-box domain-containing protein 53 OS=Arabidopsis thaliana GN=PUB53 PE=3 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 6.304e-26
Identity = 56/89 (62.92%), Postives = 75/89 (84.27%), Query Frame = 3
Query:   18 VYAYGMVILQLLTAKPAIAITHKVETAID---EDNLAEILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLKEVAD 275
            VYA+GM+ILQLLT + A+A+T+ VETA++   +D L +ILD +AG+WPI+ET++LAAL L C ELR KDRPDL++Q+LPVLE LK+VAD
Sbjct:  648 VYAFGMIILQLLTGQQAMALTYTVETAMENNNDDELIQILDEKAGNWPIEETRQLAALALQCTELRSKDRPDLEDQILPVLESLKKVAD 736          
BLAST of CX296749 vs. ExPASy Swiss-Prot
Match: PUB51_ARATH (U-box domain-containing protein 51 OS=Arabidopsis thaliana GN=PUB51 PE=2 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 3.824e-23
Identity = 47/87 (54.02%), Postives = 67/87 (77.01%), Query Frame = 3
Query:   18 VYAYGMVILQLLTAKPAIAITHKVETAIDEDN--LAEILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLKEVA 272
            +YA+G+++LQL+TA+ A+ + H +E A+ +      EILD  AGDWP+KE KE+  +GL CAE+R++DRPDL  ++LPVLERLKEVA
Sbjct:  621 IYAFGIILLQLVTARSAMGLAHSIEKALRDQTGKFTEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGKEILPVLERLKEVA 707          
BLAST of CX296749 vs. ExPASy Swiss-Prot
Match: PUB34_ARATH (U-box domain-containing protein 34 OS=Arabidopsis thaliana GN=PUB34 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.776e-20
Identity = 46/86 (53.49%), Postives = 63/86 (73.26%), Query Frame = 3
Query:   18 VYAYGMVILQLLTAKPAIAITHKVETAIDEDNLAEILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLKEVAD 275
            +YA+G++ILQLLTA+    I   VE A+ +  L E+LD    DWP+ ET+ELA +GL CAE R +DRPDLK++V+PVL+RL E A+
Sbjct:  628 LYAFGIIILQLLTARNPSGIVPAVENAVKKGTLTEMLDKSVTDWPLAETEELARIGLKCAEFRCRDRPDLKSEVIPVLKRLVETAN 713          
BLAST of CX296749 vs. ExPASy Swiss-Prot
Match: PUB33_ARATH (U-box domain-containing protein 33 OS=Arabidopsis thaliana GN=PUB33 PE=2 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 1.115e-14
Identity = 35/82 (42.68%), Postives = 58/82 (70.73%), Query Frame = 3
Query:   18 VYAYGMVILQLLTAKPAIAITHKVETAIDEDNLAEILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLK 263
            VY++G+++L+LLT +PA+ I+++V+ A+D   L ++LD  AGDWP  + ++LA L L C E   ++RPDL  +V  VLE ++
Sbjct:  663 VYSFGIILLRLLTGRPALRISNEVKYALDNGTLNDLLDPLAGDWPFVQAEQLARLALRCCETVSENRPDLGTEVWRVLEPMR 744          
BLAST of CX296749 vs. ExPASy Swiss-Prot
Match: PUB32_ARATH (U-box domain-containing protein 32 OS=Arabidopsis thaliana GN=PUB32 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.686e-13
Identity = 33/82 (40.24%), Postives = 54/82 (65.85%), Query Frame = 3
Query:   18 VYAYGMVILQLLTAKPAIAITHKVETAIDEDNLAEILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLK 263
            +YA+G+++LQLLT +P   I   V+ A++ DN++ +LD  AGDWP+   K+LA + + C +    +RPDL   VL  ++R+K
Sbjct:  634 IYAFGIILLQLLTRRPVSGILRDVKCALENDNISAVLDNSAGDWPVARGKKLANVAIRCCKKNPMNRPDLA-VVLRFIDRMK 714          
The following BLAST results are available for this feature:
BLAST of CX296749 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
PUB35_ARATH4.365e-2765.52U-box domain-containing protein 35 OS=Arabidopsis ... [more]
PUB52_ARATH5.701e-2766.67U-box domain-containing protein 52 OS=Arabidopsis ... [more]
PUB53_ARATH6.304e-2662.92Putative U-box domain-containing protein 53 OS=Ara... [more]
PUB51_ARATH3.824e-2354.02U-box domain-containing protein 51 OS=Arabidopsis ... [more]
PUB34_ARATH1.776e-2053.49U-box domain-containing protein 34 OS=Arabidopsis ... [more]
PUB33_ARATH1.115e-1442.68U-box domain-containing protein 33 OS=Arabidopsis ... [more]
PUB32_ARATH4.686e-1340.24U-box domain-containing protein 32 OS=Arabidopsis ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05802D03SK FerrChloL1 Citrus clementina cDNA clone C05802D03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296749 ID=CX296749|Name=CX296749|organism=Citrus clementina|type=EST|length=277bp
CCGAATTCGGCACGAGGGTTTATGCTTATGGAATGGTAATTCTGCAATTG
CTGACTGCGAAGCCAGCAATAGCGATAACCCACAAGGTGGAAACAGCAAT
TGATGAGGATAATTTAGCCGAGATTCTTGATGCACAAGCTGGTGATTGGC
CTATTAAAGAGACAAAGGAACTGGCTGCATTGGGACTGAGCTGTGCGGAG
CTAAGGCGAAAGGACAGGCCTGACTTAAAAAATCAAGTACTTCCTGTTCT
GGAGAGATTAAAGGAGGTTGCTGATAG
back to top