CX296750

Overview
NameCX296750
Unique NameCX296750
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length582
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig4958 contig Ccv1_Contig4958:410..991. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296750 vs. ExPASy Swiss-Prot
Match: HSP71_RAT (Heat shock 70 kDa protein 1A/1B OS=Rattus norvegicus GN=Hspa1a PE=2 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 3.637e-21
Identity = 64/176 (36.36%), Postives = 99/176 (56.25%), Query Frame = 3
Query:   45 IFNMKRLIGRVDTDPVVHAS-KSLPFLVQTVDIGVRPFIAALVNNAWRSTTPEEVLAIFLVELRAMAETQLKRPIRNVVLTIPVSFSRFQLTRIERACAMAGLHVLRLMPEPTAVALLYAXXXXXSVHENLGSGSEKIAVIFNMGAGYCDVTVSATAGGVSQIKALSGSA-IGGED 566
            +F+ KRLIGR   DPVV +  K  PF  Q V+ G +P +        RS  PEE+ ++ L +++ +AE  L  P+ N V+T+P  F+  Q    + A  +AGL+VLR++ EPTA A+ Y         +  G G E+  +IF++G G  DV++     G+ ++KA +G   +GGED
Sbjct:   67 VFDAKRLIGRKFGDPVVQSDMKHWPF--QVVNDGDKPKVQVNYKGENRSFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGL-------DRTGKG-ERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGED 232          
BLAST of CX296750 vs. ExPASy Swiss-Prot
Match: HS71L_HUMAN (Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 4.750e-21
Identity = 62/176 (35.23%), Postives = 97/176 (55.11%), Query Frame = 3
Query:   45 IFNMKRLIGRVDTDPVVHASKSL-PFLVQTVDIGVRPFIAALVNNAWRSTTPEEVLAIFLVELRAMAETQLKRPIRNVVLTIPVSFSRFQLTRIERACAMAGLHVLRLMPEPTAVALLYAXXXXXSVHENLGSGSEKIAVIFNMGAGYCDVTVSATAGGVSQIKALSGSA-IGGED 566
            +F+ KRLIGR   DPVV A   L PF  Q ++ G +P +        ++  PEE+ ++ L +L+  AE  L  P+ N V+T+P  F+  Q    + A  +AGL+VLR++ EPTA A+ Y          + G   E+  +IF++G G  DV++     G+ ++KA +G   +GGED
Sbjct:   69 VFDAKRLIGRKFNDPVVQADMKLWPF--QVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGL--------DKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGED 234          
BLAST of CX296750 vs. ExPASy Swiss-Prot
Match: HSP76_PIG (Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 8.102e-21
Identity = 64/176 (36.36%), Postives = 100/176 (56.82%), Query Frame = 3
Query:   45 IFNMKRLIGRVDTDPVVHAS-KSLPFLVQTVDIGVRPFIAALVNNAWRSTTPEEVLAIFLVELRAMAETQLKRPIRNVVLTIPVSFSRFQLTRIERACAMAGLHVLRLMPEPTAVALLYAXXXXXSVHENLGSGSEKIAVIFNMGAGYCDVTVSATAGGVSQIKALSGSA-IGGED 566
            +F+ KRLIGR   DP V +  K  PF  Q V  G +P +        ++  PEE+ ++ L +++  AE  L +P+R+ V+T+P  F+  Q    + A A+AGL+VLR++ EPTA A+ Y         +  G+G E+  +IF++G G  DV+V     GV ++KA +G   +GGED
Sbjct:   69 VFDAKRLIGRKFADPTVQSDLKHWPF--QVVSEGGKPKVRVSYRGEDKAFYPEEISSMVLSKMKETAEAYLGQPVRHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL-------DRRGAG-ERNVLIFDLGGGTFDVSVLTIDAGVFEVKATAGDTHLGGED 234          
BLAST of CX296750 vs. ExPASy Swiss-Prot
Match: HSP70_TRYCR (Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=HSP70 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 8.102e-21
Identity = 62/176 (35.23%), Postives = 99/176 (56.25%), Query Frame = 3
Query:   45 IFNMKRLIGRVDTDPVVHAS-KSLPFLVQTVDIGVRPFIAALVNNAWRSTTPEEVLAIFLVELRAMAETQLKRPIRNVVLTIPVSFSRFQLTRIERACAMAGLHVLRLMPEPTAVALLYAXXXXXSVHENLGSGSEKIAVIFNMGAGYCDVTVSATAGGVSQIKALSGSA-IGGED 566
            +F+ KRLIGR  +DPVV +  K  PF V T     +P I        ++  PEEV ++ L +++ +AE+ L + ++  V+T+P  F+  Q    + A  +AGL VLR++ EPTA A+ Y         + +  G E+  +IF++G G  DVT+    GG+ ++KA +G   +GGED
Sbjct:   67 VFDAKRLIGRKFSDPVVQSDMKHWPFKVITKGDD-KPVIQVQFRGETKTFNPEEVSSMVLSKMKEIAESYLGKQVKKAVVTVPAYFNDSQRQATKDAGTIAGLEVLRIINEPTAAAIAYGL-------DKVEDGKERNVLIFDLGGGTFDVTLLTIDGGIFEVKATNGDTHLGGED 234          
BLAST of CX296750 vs. ExPASy Swiss-Prot
Match: HSP70_PYRSA (Heat shock 70 kDa protein OS=Pyrenomonas salina GN=HSP70 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 8.102e-21
Identity = 62/176 (35.23%), Postives = 99/176 (56.25%), Query Frame = 3
Query:   45 IFNMKRLIGRVDTDPVVHAS-KSLPFLVQTVDIGVRPFIAALVNNAWRSTTPEEVLAIFLVELRAMAETQLKRPIRNVVLTIPVSFSRFQLTRIERACAMAGLHVLRLMPEPTAVALLYAXXXXXSVHENLGSGSEKIAVIFNMGAGYCDVTVSATAGGVSQIKALSGSA-IGGED 566
            +F+ KRLIGR   DP V    K  PF V   D G +P +        +   PEE+ ++ L++++ +AE+ L + ++N V+T+P  F+  Q    + A A+ GL+VLR++ EPTA A+ Y      S     GS SE+  +IF++G G  DV++     G+ ++KA +G   +GGED
Sbjct:   70 VFDAKRLIGRRFQDPAVQEDVKPFPFKVICKD-GDKPAVEVKYKGETKIFAPEEISSMVLLKMKEIAESFLGKEVKNAVITVPAYFNDSQRQATKDAGAITGLNVLRIINEPTAAAIAYGLDKKTS-----GSKSERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGED 239          
BLAST of CX296750 vs. ExPASy Swiss-Prot
Match: HS71B_PIG (Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA1B PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.058e-20
Identity = 62/176 (35.23%), Postives = 99/176 (56.25%), Query Frame = 3
Query:   45 IFNMKRLIGRVDTDPVVHAS-KSLPFLVQTVDIGVRPFIAALVNNAWRSTTPEEVLAIFLVELRAMAETQLKRPIRNVVLTIPVSFSRFQLTRIERACAMAGLHVLRLMPEPTAVALLYAXXXXXSVHENLGSGSEKIAVIFNMGAGYCDVTVSATAGGVSQIKALSGSA-IGGED 566
            +F+ KRLIGR   DPVV A  K  PF V  ++ G +P +        ++  PEE+ ++ L +++ +AE  L  P+ N V+T+P  F+  Q    + A  +AGL+VLR++ EPTA A+ Y         +  G G E+  +IF++G G  DV++     G+ ++KA +G   +GGED
Sbjct:   67 VFDAKRLIGRKFGDPVVQADMKHWPFRV--INDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGL-------DRTGKG-ERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGED 232          
BLAST of CX296750 vs. ExPASy Swiss-Prot
Match: HSP71_CANFA (Heat shock 70 kDa protein 1 OS=Canis familiaris GN=HSPA1 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.382e-20
Identity = 62/176 (35.23%), Postives = 99/176 (56.25%), Query Frame = 3
Query:   45 IFNMKRLIGRVDTDPVVHAS-KSLPFLVQTVDIGVRPFIAALVNNAWRSTTPEEVLAIFLVELRAMAETQLKRPIRNVVLTIPVSFSRFQLTRIERACAMAGLHVLRLMPEPTAVALLYAXXXXXSVHENLGSGSEKIAVIFNMGAGYCDVTVSATAGGVSQIKALSGSA-IGGED 566
            +F+ KRLIGR   DPVV +  K  PF  Q V+ G +P +        ++  PEE+ ++ L +++ +AE  L  P+ N V+T+P  F+  Q    + A  +AGL+VLR++ EPTA A+ Y         +  G G E+  +IF++G G  DV++     G+ ++KA +G   +GGED
Sbjct:   67 VFDAKRLIGRKFGDPVVQSDMKHWPF--QVVNDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGL-------DRTGKG-ERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGED 232          
BLAST of CX296750 vs. ExPASy Swiss-Prot
Match: HSP71_PONAB (Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSPA1 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.805e-20
Identity = 61/176 (34.66%), Postives = 99/176 (56.25%), Query Frame = 3
Query:   45 IFNMKRLIGRVDTDPVVHAS-KSLPFLVQTVDIGVRPFIAALVNNAWRSTTPEEVLAIFLVELRAMAETQLKRPIRNVVLTIPVSFSRFQLTRIERACAMAGLHVLRLMPEPTAVALLYAXXXXXSVHENLGSGSEKIAVIFNMGAGYCDVTVSATAGGVSQIKALSGSA-IGGED 566
            +F+ KRLIGR   DPVV +  K  PF  Q ++ G +P +        ++  PEE+ ++ L +++ +AE  L  P+ N V+T+P  F+  Q    + A  +AGL+VLR++ EPTA A+ Y         +  G G E+  +IF++G G  DV++     G+ ++KA +G   +GGED
Sbjct:   67 VFDAKRLIGRKFGDPVVQSDMKHWPF--QVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGL-------DRTGKG-ERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGED 232          
BLAST of CX296750 vs. ExPASy Swiss-Prot
Match: HSP71_HUMAN (Heat shock 70 kDa protein 1A/1B OS=Homo sapiens GN=HSPA1A PE=1 SV=5)

HSP 1 Score: 98.9821 bits (245), Expect = 1.805e-20
Identity = 61/176 (34.66%), Postives = 99/176 (56.25%), Query Frame = 3
Query:   45 IFNMKRLIGRVDTDPVVHAS-KSLPFLVQTVDIGVRPFIAALVNNAWRSTTPEEVLAIFLVELRAMAETQLKRPIRNVVLTIPVSFSRFQLTRIERACAMAGLHVLRLMPEPTAVALLYAXXXXXSVHENLGSGSEKIAVIFNMGAGYCDVTVSATAGGVSQIKALSGSA-IGGED 566
            +F+ KRLIGR   DPVV +  K  PF  Q ++ G +P +        ++  PEE+ ++ L +++ +AE  L  P+ N V+T+P  F+  Q    + A  +AGL+VLR++ EPTA A+ Y         +  G G E+  +IF++G G  DV++     G+ ++KA +G   +GGED
Sbjct:   67 VFDAKRLIGRKFGDPVVQSDMKHWPF--QVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGL-------DRTGKG-ERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGED 232          
BLAST of CX296750 vs. ExPASy Swiss-Prot
Match: HSP70_HYDMA (Heat shock 70 kDa protein OS=Hydra magnipapillata GN=HSP70.1 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.805e-20
Identity = 63/176 (35.80%), Postives = 99/176 (56.25%), Query Frame = 3
Query:   45 IFNMKRLIGRVDTDPVVHAS-KSLPFLVQTVDIGVRPFIAALVNNAWRSTTPEEVLAIFLVELRAMAETQLKRPIRNVVLTIPVSFSRFQLTRIERACAMAGLHVLRLMPEPTAVALLYAXXXXXSVHENLGSGSEKIAVIFNMGAGYCDVTVSATAGGVSQIKALSGSA-IGGED 566
            +F+ KRLIGR   DP V +  K  PF V  +D G RP I        +S  PEE+ ++ L+++  +A+  L + + +VV+T+P  F+  Q    + A  +AGL+VLR++ EPTA A+ Y              G+EK  +IF++G G  DV++ A   G+ +IK+ +G   +GGED
Sbjct:   67 VFDAKRLIGRKFNDPSVTSDRKHWPFNV--IDDGSRPKIQVEFKGETKSFYPEEISSMVLLKMEEIADAYLGKKVTDVVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKV--------GTEKNVLIFDLGGGTFDVSILAIEDGIFEIKSTAGDTHLGGED 232          
The following BLAST results are available for this feature:
BLAST of CX296750 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP71_RAT3.637e-2136.36Heat shock 70 kDa protein 1A/1B OS=Rattus norvegic... [more]
HS71L_HUMAN4.750e-2135.23Heat shock 70 kDa protein 1-like OS=Homo sapiens G... [more]
HSP76_PIG8.102e-2136.36Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6... [more]
HSP70_TRYCR8.102e-2135.23Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=... [more]
HSP70_PYRSA8.102e-2135.23Heat shock 70 kDa protein OS=Pyrenomonas salina GN... [more]
HS71B_PIG1.058e-2035.23Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA... [more]
HSP71_CANFA1.382e-2035.23Heat shock 70 kDa protein 1 OS=Canis familiaris GN... [more]
HSP71_PONAB1.805e-2034.66Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSP... [more]
HSP71_HUMAN1.805e-2034.66Heat shock 70 kDa protein 1A/1B OS=Homo sapiens GN... [more]
HSP70_HYDMA1.805e-2035.80Heat shock 70 kDa protein OS=Hydra magnipapillata ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05802D04SK FerrChloL1 Citrus clementina cDNA clone C05802D04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296750 ID=CX296750|Name=CX296750|organism=Citrus clementina|type=EST|length=582bp
GAGGCTCACTCTCCCATGAACATGAAATGTTATCTGGAGCTGCTATTTTC
AACATGAAACGCTTAATCGGCAGAGTTGACACCGATCCTGTGGTCCATGC
AAGCAAAAGCTTACCGTTTTTGGTCCAAACCGTGGACATTGGTGTTCGTC
CATTTATTGCAGCCTTAGTGAACAATGCGTGGAGATCCACCACTCCCGAA
GAAGTCCTGGCAATATTTTTGGTGGAACTAAGAGCCATGGCTGAAACTCA
GTTGAAACGCCCAATAAGAAATGTTGTTCTAACCATTCCAGTTTCATTCA
GTCGTTTCCAACTGACACGCATTGAACGAGCATGTGCTATGGCTGGCCTT
CATGTCCTCAGACTTATGCCTGAACCAACTGCTGTAGCTCTATTGTATGC
TCAGCAGCAGCAACAGAGTGTGCATGAGAATTTGGGCAGTGGAAGTGAGA
AGATTGCGGTCATTTTCAATATGGGTGCTGGGTACTGTGATGTCACTGTG
AGTGCTACAGCTGGAGGAGTTTCACAGATTAAAGCTTTATCAGGAAGTGC
TATTGGAGGAGAGGATTTACTTCAGAATATGA
back to top