CX296849

Overview
NameCX296849
Unique NameCX296849
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length303
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig588 contig Ccv1_Contig588:998..1300. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296849 vs. ExPASy Swiss-Prot
Match: RCA1_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Larrea tridentata GN=RCA1 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 6.107e-37
Identity = 73/99 (73.74%), Postives = 79/99 (79.80%), Query Frame = 3
Query:    6 LVPNSARGKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 302
            L+ +    KFYWAPTREDRIGVCKGIFR DNVADDDIVKLVDTFPGQSIDFFGALRARVY DEVRKW          K LVNSKE  P+FEQP+MT++K
Sbjct:  294 LIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVADDDIVKLVDTFPGQSIDFFGALRARVYHDEVRKWVSEVGVDTIGKKLVNSKEGPPSFEQPKMTIDK 392          
BLAST of CX296849 vs. ExPASy Swiss-Prot
Match: RCA_MALDO (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Malus domestica GN=RCA PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.777e-36
Identity = 73/99 (73.74%), Postives = 79/99 (79.80%), Query Frame = 3
Query:    6 LVPNSARGKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 302
            L+ +    KFYWAPTREDRIGVC GIFR+DNVA +DIVKLVDTFPGQSIDFFGALRARVYDDEVRKW          K LVNSKE  PTFEQP+MT+EK
Sbjct:  294 LIRDGRMEKFYWAPTREDRIGVCIGIFRSDNVAKEDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWITGVGVDSIGKKLVNSKEGPPTFEQPKMTIEK 392          
BLAST of CX296849 vs. ExPASy Swiss-Prot
Match: RCA2_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Larrea tridentata GN=RCA2 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.152e-35
Identity = 70/99 (70.71%), Postives = 78/99 (78.79%), Query Frame = 3
Query:    6 LVPNSARGKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 302
            L+ +    KFYWAPTREDRIGVCKGIFR DNV ++DIVK+VD FPGQSIDFFGALRARVYDDEVRKW          K LVNSKE  PTFEQP+MT++K
Sbjct:  294 LIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVPEEDIVKVVDQFPGQSIDFFGALRARVYDDEVRKWVSEVGVDTIGKKLVNSKEGPPTFEQPKMTIDK 392          
BLAST of CX296849 vs. ExPASy Swiss-Prot
Match: RCAB_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase B, chloroplastic OS=Hordeum vulgare GN=RCAB PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.566e-35
Identity = 69/99 (69.70%), Postives = 78/99 (78.79%), Query Frame = 3
Query:    6 LVPNSARGKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 302
            L+ +    KFYWAPTREDRIGVCKGIFR DNV D+ +V+LVDTFPGQSIDFFGALRARVYDDEVRKW          K LVNS+E  PTF+QP+MT+EK
Sbjct:  281 LIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVPDEAVVRLVDTFPGQSIDFFGALRARVYDDEVRKWVGEIGVENISKRLVNSREGPPTFDQPKMTIEK 379          
BLAST of CX296849 vs. ExPASy Swiss-Prot
Match: RCA_ORYSJ (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Oryza sativa subsp. japonica GN=RCA PE=1 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 3.351e-35
Identity = 68/99 (68.69%), Postives = 78/99 (78.79%), Query Frame = 3
Query:    6 LVPNSARGKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 302
            L+ +    KFYWAPTR+DR+GVCKGIFR DNV D+DIVK+VD+FPGQSIDFFGALRARVYDDEVRKW          K LVNS+E  P FEQP+MT+EK
Sbjct:  285 LIRDGRMEKFYWAPTRDDRVGVCKGIFRTDNVPDEDIVKIVDSFPGQSIDFFGALRARVYDDEVRKWVSDTGVENIGKRLVNSREGPPEFEQPKMTIEK 383          
BLAST of CX296849 vs. ExPASy Swiss-Prot
Match: RCA_CUCSA (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.273e-34
Identity = 68/99 (68.69%), Postives = 78/99 (78.79%), Query Frame = 3
Query:    6 LVPNSARGKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 302
            L+ +    KFYWAPTREDRIG+C GIFR D V  +DIVKLVDTFPGQSIDFFGALRARVYDDEVRKW          ++LVNSKE+ PTF+QP+MT+EK
Sbjct:  291 LIRDGRMDKFYWAPTREDRIGICTGIFRTDGVPFEDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWAVGVGVERIGRNLVNSKESPPTFDQPKMTIEK 389          
BLAST of CX296849 vs. ExPASy Swiss-Prot
Match: RCA_PHAAU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus aureus GN=RCA PE=2 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 2.172e-34
Identity = 66/99 (66.67%), Postives = 77/99 (77.78%), Query Frame = 3
Query:    6 LVPNSARGKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 302
            L+ +    KFYWAPTR+DR+GVCKGIFR D V ++DI KLVDTFPGQSIDFFGALRARVYDDEVRKW          K LVNSKE  PTF+QP+M+++K
Sbjct:  296 LIRDGRMEKFYWAPTRDDRVGVCKGIFRTDGVPEEDITKLVDTFPGQSIDFFGALRARVYDDEVRKWISGVGVDATGKKLVNSKEGPPTFDQPKMSLDK 394          
BLAST of CX296849 vs. ExPASy Swiss-Prot
Match: RCAA_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase A, chloroplastic OS=Hordeum vulgare GN=RCAA PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.839e-34
Identity = 66/99 (66.67%), Postives = 78/99 (78.79%), Query Frame = 3
Query:    6 LVPNSARGKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 302
            L+ +    KFYWAPTR+DRIGVCKGIF+ DNV+D+ +VK+VDTFPGQSIDFFGALRARVYDDEVRKW          K LVNS++   TFEQP+MT+EK
Sbjct:  284 LIRDGRMEKFYWAPTRDDRIGVCKGIFQTDNVSDESVVKIVDTFPGQSIDFFGALRARVYDDEVRKWVGSTGIENIGKRLVNSRDGPVTFEQPKMTVEK 382          
BLAST of CX296849 vs. ExPASy Swiss-Prot
Match: RCA_SOLPN (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Solanum pennellii PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 6.320e-34
Identity = 65/99 (65.66%), Postives = 78/99 (78.79%), Query Frame = 3
Query:    6 LVPNSARGKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 302
            L+ +    KFYWAPTREDRIGVCKGIFR DNV ++ +VK+VD+FPGQSIDFFGALRARVYDDEVRKW          + L+NS++  PTFEQP+MT+EK
Sbjct:  293 LIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVPEEAVVKIVDSFPGQSIDFFGALRARVYDDEVRKWVSGTGIELIGEKLLNSRDGPPTFEQPKMTLEK 391          
BLAST of CX296849 vs. ExPASy Swiss-Prot
Match: RCA_MAIZE (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Zea mays GN=RCA1 PE=2 SV=3)

HSP 1 Score: 141.739 bits (356), Expect = 1.078e-33
Identity = 66/99 (66.67%), Postives = 77/99 (77.78%), Query Frame = 3
Query:    6 LVPNSARGKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEK 302
            L+ +    KFYWAPTREDRIGVCKGIFR D V ++ +V+LVDTFPGQSIDFFGALRARVYDDEVR+W          + LVNSKE  PTFEQP++T+EK
Sbjct:  290 LIRDGRMEKFYWAPTREDRIGVCKGIFRTDGVDEEHVVQLVDTFPGQSIDFFGALRARVYDDEVRRWVSETGVENIARKLVNSKEGPPTFEQPKITIEK 388          
The following BLAST results are available for this feature:
BLAST of CX296849 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
RCA1_LARTR6.107e-3773.74Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_MALDO1.777e-3673.74Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_LARTR1.152e-3570.71Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAB_HORVU2.566e-3569.70Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ORYSJ3.351e-3568.69Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_CUCSA1.273e-3468.69Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAAU2.172e-3466.67Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAA_HORVU4.839e-3466.67Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_SOLPN6.320e-3465.66Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_MAIZE1.078e-3366.67Ribulose bisphosphate carboxylase/oxygenase activa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05803E04SK FerrChloL1 Citrus clementina cDNA clone C05803E04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296849 ID=CX296849|Name=CX296849|organism=Citrus clementina|type=EST|length=303bp
GAGGCCTCGTGCCGAATTCGGCACGAGGGAAATTCTACTGGGCACCTACA
AGGGAGGACCGTATTGGTGTGTGCAAGGGTATCTTCAGGAATGACAATGT
GGCTGATGACGACATTGTCAAGCTTGTCGACACCTTCCCCGGCCAATCCA
TTGATTTCTTTGGAGCCCTGAGGGCCAGAGTCTATGATGATGAGGTGAGG
AAGTGGATCTCTGGTGTTGGTGTTGGAAGCATTGGCAAGAGCCTTGTGAA
CTCAAAGGAAGCAGCCCCAACATTCGAGCAACCAAGGATGACAATGGAGA
AGC
back to top