CX296850

Overview
NameCX296850
Unique NameCX296850
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length208
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9336 contig Ccv1_Contig9336:235..442. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296850 vs. ExPASy Swiss-Prot
Match: UBIQ_WHEAT (Ubiquitin OS=Triticum aestivum PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.172e-20
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 3
Query:   63 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 206
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 48          
BLAST of CX296850 vs. ExPASy Swiss-Prot
Match: UBIQ_SOYBN (Ubiquitin OS=Glycine max GN=SUBI-1 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.172e-20
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 3
Query:   63 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 206
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 48          
BLAST of CX296850 vs. ExPASy Swiss-Prot
Match: UBIQ_SOLTU (Ubiquitin OS=Solanum tuberosum GN=UBI3 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.172e-20
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 3
Query:   63 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 206
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 48          
BLAST of CX296850 vs. ExPASy Swiss-Prot
Match: UBIQ_SOLLC (Ubiquitin OS=Solanum lycopersicum GN=UBI3 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.172e-20
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 3
Query:   63 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 206
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 48          
BLAST of CX296850 vs. ExPASy Swiss-Prot
Match: UBIQ_PETCR (Ubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.172e-20
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 3
Query:   63 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 206
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 48          
BLAST of CX296850 vs. ExPASy Swiss-Prot
Match: UBIQ_PEA (Ubiquitin OS=Pisum sativum GN=PU1 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.172e-20
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 3
Query:   63 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 206
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 48          
BLAST of CX296850 vs. ExPASy Swiss-Prot
Match: UBIQ_ORYSJ (Ubiquitin OS=Oryza sativa subsp. japonica GN=UBQ1 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.172e-20
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 3
Query:   63 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 206
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 48          
BLAST of CX296850 vs. ExPASy Swiss-Prot
Match: UBIQ_NICSY (Ubiquitin OS=Nicotiana sylvestris GN=UBICEP52-7 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.172e-20
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 3
Query:   63 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 206
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 48          
BLAST of CX296850 vs. ExPASy Swiss-Prot
Match: UBIQ_MAIZE (Ubiquitin OS=Zea mays GN=UBF9 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.172e-20
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 3
Query:   63 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 206
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 48          
BLAST of CX296850 vs. ExPASy Swiss-Prot
Match: UBIQ_LUPPO (Ubiquitin OS=Lupinus polyphyllus PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.172e-20
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 3
Query:   63 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 206
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 48          
The following BLAST results are available for this feature:
BLAST of CX296850 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 81
Match NameE-valueIdentityDescription
UBIQ_WHEAT5.172e-20100.00Ubiquitin OS=Triticum aestivum PE=3 SV=1[more]
UBIQ_SOYBN5.172e-20100.00Ubiquitin OS=Glycine max GN=SUBI-1 PE=3 SV=1[more]
UBIQ_SOLTU5.172e-20100.00Ubiquitin OS=Solanum tuberosum GN=UBI3 PE=3 SV=1[more]
UBIQ_SOLLC5.172e-20100.00Ubiquitin OS=Solanum lycopersicum GN=UBI3 PE=3 SV=... [more]
UBIQ_PETCR5.172e-20100.00Ubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=3... [more]
UBIQ_PEA5.172e-20100.00Ubiquitin OS=Pisum sativum GN=PU1 PE=3 SV=1[more]
UBIQ_ORYSJ5.172e-20100.00Ubiquitin OS=Oryza sativa subsp. japonica GN=UBQ1 ... [more]
UBIQ_NICSY5.172e-20100.00Ubiquitin OS=Nicotiana sylvestris GN=UBICEP52-7 PE... [more]
UBIQ_MAIZE5.172e-20100.00Ubiquitin OS=Zea mays GN=UBF9 PE=3 SV=1[more]
UBIQ_LUPPO5.172e-20100.00Ubiquitin OS=Lupinus polyphyllus PE=3 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05803E05SK FerrChloL1 Citrus clementina cDNA clone C05803E05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296850 ID=CX296850|Name=CX296850|organism=Citrus clementina|type=EST|length=208bp
TGGCCGATTACAATATCCAAAAGGAATCCACGCTTCATCTGGTGCTTCGT
CTCCGTGGAGGCATGCAGATCTTCGTGAAAACCCTAACCGGCAAGACCAT
TACTCTCGAAGTTGAGAGCTCCGACACGATCGACAACGTCAAGGCCAAGA
TCCAGGACAAGGAAGGGATTCCGCCGGACCAGCAGAGGCTGATCTTCGCC
GGAAAGCA
back to top