CX296879

Overview
NameCX296879
Unique NameCX296879
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length728
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX296879_ssr37 microsatellite CX296879_ssr37:37..51. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig13744 contig Ccv1_Contig13744:111..838. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296879 vs. ExPASy Swiss-Prot
Match: Y3761_ARATH (Uncharacterized protein At3g17611 OS=Arabidopsis thaliana GN=At3g17611 PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 7.188e-85
Identity = 148/195 (75.90%), Postives = 173/195 (88.72%), Query Frame = 3
Query:   57 RVSRGMLPLLALHAFNEYHRLPWKPPVTAALLATNTLIYLRPAFLDSLVPSIHEVWFNPHLILKYKDLKRFFLSPFYHASESHLFYNMMSLLWKGIQLETSMGSNEFAAMVVALLGMSQGITLLLAKSLVLFFDYERAYYSEYAVGFSGVLFAMKVVLNSRSEDYTNVHGLLVPARYAAWAELIIIQMFVPGVSF 641
            R   GMLPLLAL A  EY+RLPWKPPVTA+LLA NTL+YLRPAF+D ++P I EVWFNPHLI K+KDLKR FLS FYH +E HL YNMMSLLWKGI+LETSMGS+EFA+MV  L+GMSQG+TLLLAKSL+L FDY+RAYY+EYAVGFSGVLFAMKVVLNS++EDY++V+G+LVP +YAAWAELI++QMFVP  SF
Sbjct:    9 RSGGGMLPLLALSAVAEYYRLPWKPPVTASLLAANTLVYLRPAFIDPVIPHISEVWFNPHLIFKHKDLKRLFLSAFYHVNEPHLVYNMMSLLWKGIKLETSMGSSEFASMVFTLIGMSQGVTLLLAKSLLLLFDYDRAYYNEYAVGFSGVLFAMKVVLNSQAEDYSSVYGILVPTKYAAWAELILVQMFVPNASF 203          
BLAST of CX296879 vs. ExPASy Swiss-Prot
Match: RHBD1_HUMAN (Rhomboid domain-containing protein 1 OS=Homo sapiens GN=RHBDD1 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.394e-26
Identity = 69/172 (40.12%), Postives = 96/172 (55.81%), Query Frame = 3
Query:  129 PPVTAALLATNTLIYLRPAFLDSLVPSIHEVWFNPHLILKYKDLKRFFLSPFYHASESHLFYNMMSLLWKGIQLETSMGSNEFAAMVVALLGMSQGITLLLAKSLVLFFDYERAYYSEYAVGFSGVLFAMKVVLNSRSE-DYTNVHGLLVPARYAAWAELIIIQMFVPGVSF 641
            PPVT A LA N   +L P         ++    +     + KD +R  LSP +HA + HL++NM S+LWKGI LE  +GS  FA ++ A   ++  + LLL  ++  F D E  +    AVGFSGVLFA+KV+ N      + N+ G  VP R+A W EL+ I +F PG SF
Sbjct:   28 PPVTLATLALNIWFFLNPQ------KPLYSSCLSVEKCYQQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYLLLQFAVAEFMD-EPDFKRSCAVGFSGVLFALKVLNNHYCPGGFVNILGFPVPNRFACWVELVAIHLFSPGTSF 192          
BLAST of CX296879 vs. ExPASy Swiss-Prot
Match: RHBD1_MOUSE (Rhomboid domain-containing protein 1 OS=Mus musculus GN=Rhbdd1 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 6.400e-25
Identity = 68/172 (39.53%), Postives = 93/172 (54.07%), Query Frame = 3
Query:  129 PPVTAALLATNTLIYLRPAFLDSLVPSIHEVWFNPHLILKYKDLKRFFLSPFYHASESHLFYNMMSLLWKGIQLETSMGSNEFAAMVVALLGMSQGITLLLAKSLVLFFDYERAYYSEYAVGFSGVLFAMKVVLNSRSE-DYTNVHGLLVPARYAAWAELIIIQMFVPGVSF 641
            PPVT A LA N   +L P       P  H    +     + KD +R  LSP +H  + HL++NM+S+LWKG++LE  +GS  F A V+A   +  G+  LL +  V     +  +    AVGFSGVLFA+KV+ N      + N+ G  VP R+A WAEL+ I    PG SF
Sbjct:   28 PPVTLATLAVNVWFFLNP-----WKPLYHSC-ISVEKCYQQKDWQRLLLSPLHHGDDWHLYFNMVSMLWKGVKLERRLGSRWF-AYVIATFSLLTGVVYLLLQFTVAELLNQPDFKRNCAVGFSGVLFALKVLSNHYCPGGFVNILGFPVPNRFACWAELVAIHFCTPGTSF 192          
BLAST of CX296879 vs. ExPASy Swiss-Prot
Match: RHBD1_PONAB (Rhomboid domain-containing protein 1 OS=Pongo abelii GN=RHBDD1 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.092e-24
Identity = 67/172 (38.95%), Postives = 92/172 (53.49%), Query Frame = 3
Query:  129 PPVTAALLATNTLIYLRPAFLDSLVPSIHEVWFNPHLILKYKDLKRFFLSPFYHASESHLFYNMMSLLWKGIQLETSMGSNEFAAMVVALLGMSQGITLLLAKSLVLFFDYERAYYSEYAVGFSGVLFAMKVVLNSRSE-DYTNVHGLLVPARYAAWAELIIIQMFVPGVSF 641
            PPVT A LA N   +L P         ++    +     + +D +R  LSP +HA + HL++N  S+LWKGI LE  +GS  F A V+    +  G+  LL +  V  F  E  +    AVGFSGVLFA+KV+ N      + N+ G  VP R+A W EL+ I +F PG SF
Sbjct:   28 PPVTLATLALNIWFFLNPQ------KPLYSSCLSVEKCYQQRDWQRLLLSPLHHADDWHLYFNTASVLWKGINLERRLGSRWF-AYVITTFSVLTGVVYLLLQFAVAEFMDEPDFKRSCAVGFSGVLFALKVLNNHYCPGGFVNILGFPVPNRFACWVELVAIHLFSPGTSF 192          
BLAST of CX296879 vs. ExPASy Swiss-Prot
Match: RHBD1_RAT (Rhomboid domain-containing protein 1 OS=Rattus norvegicus GN=Rhbdd1 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.586e-23
Identity = 65/172 (37.79%), Postives = 90/172 (52.33%), Query Frame = 3
Query:  129 PPVTAALLATNTLIYLRPAFLDSLVPSIHEVWFNPHLILKYKDLKRFFLSPFYHASESHLFYNMMSLLWKGIQLETSMGSNEFAAMVVALLGMSQGITLLLAKSLVLFFDYERAYYSEYAVGFSGVLFAMKVVLNSRSE-DYTNVHGLLVPARYAAWAELIIIQMFVPGVSF 641
            PPVT A LA N   +L P       P  H    +     +  D +R  LSP +H  + HL++NM+S+LWKG++LE  +GS  F A ++A   +  G+  LL +        +  +    AVGFSGVLFA+KV+ N      + N+ G  VP R+A WAEL  I    PG SF
Sbjct:   28 PPVTLATLAVNVWFFLNP-----WKPLYHSC-ISVEKCYQQNDWQRLLLSPVHHGDDWHLYFNMVSMLWKGVKLEKRLGSRWF-AYIIATFSLLTGVVYLLLQFASAELMNQPDFKRNCAVGFSGVLFALKVLSNHYCPGGFVNILGFPVPNRFACWAELAAIHFCTPGTSF 192          
BLAST of CX296879 vs. ExPASy Swiss-Prot
Match: Y3846_ARATH (Uncharacterized protein At3g58460 OS=Arabidopsis thaliana GN=At3g58460 PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 4.303e-13
Identity = 59/175 (33.71%), Postives = 93/175 (53.14%), Query Frame = 3
Query:  129 PPVTAALLATNTLIYLRPAFLDSLVPSIHEVWFNPHLILKYKDLKRFFLSPFYHASESHLFYNMMSLLWKGIQLETSMGSNEFAAMVVALLGMSQGITLLLAKSLV---LFFDYERAYYSEYAVGFSGVLFAMKVVLNSRS-EDYTNVHGLL-VPARYAAWAELIIIQMFVPGVS 638
            P +T++++    +IYL    L +   + +EV F P  I+    + RF+ +  +H S  H+ +NMM+L+  G +LE  MGS     + V LL  +  +  LL  SL     F+ Y+    +E A+GFSG+LF+M V+  S S     +V GL  VPA+   W  LI+ Q+ +  VS
Sbjct:   23 PFLTSSVVVVCGVIYL--ICLLTGYDTFYEVCFLPSAIISRFQVYRFYTAIIFHGSLLHVLFNMMALVPMGSELERIMGSVRLLYLTV-LLATTNAVLHLLIASLAGYNPFYQYDH-LMNECAIGFSGILFSMIVIETSLSGVTSRSVFGLFNVPAKLYPWILLIVFQLLMTNVS 193          
The following BLAST results are available for this feature:
BLAST of CX296879 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
Y3761_ARATH7.188e-8575.90Uncharacterized protein At3g17611 OS=Arabidopsis t... [more]
RHBD1_HUMAN3.394e-2640.12Rhomboid domain-containing protein 1 OS=Homo sapie... [more]
RHBD1_MOUSE6.400e-2539.53Rhomboid domain-containing protein 1 OS=Mus muscul... [more]
RHBD1_PONAB1.092e-2438.95Rhomboid domain-containing protein 1 OS=Pongo abel... [more]
RHBD1_RAT4.586e-2337.79Rhomboid domain-containing protein 1 OS=Rattus nor... [more]
Y3846_ARATH4.303e-1333.71Uncharacterized protein At3g58460 OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05803G12SK FerrChloL1 Citrus clementina cDNA clone C05803G12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296879 ID=CX296879|Name=CX296879|organism=Citrus clementina|type=EST|length=728bp
GATTCGGCCGAGGATAGAATTGGTAAAAGATGGAGAGAGGAGGAGGAGGA
GGATGGAGAGTGTCGCGGGGAATGTTGCCGCTGCTGGCTCTTCACGCTTT
CAACGAGTATCACAGGCTGCCATGGAAACCGCCCGTCACCGCCGCTCTTC
TCGCCACCAACACTCTCATCTATCTCCGACCCGCCTTCCTCGATTCTCTC
GTTCCTTCTATCCATGAAGTCTGGTTCAATCCCCATCTCATCCTTAAGTA
CAAGGACCTCAAACGATTCTTCTTGTCGCCATTCTATCATGCGAGTGAAT
CTCACCTGTTCTACAATATGATGTCACTTTTATGGAAGGGGATTCAGTTG
GAAACTTCAATGGGAAGTAATGAATTTGCTGCTATGGTTGTTGCACTACT
TGGCATGTCCCAGGGCATCACACTGCTACTAGCCAAATCCCTTGTACTTT
TCTTTGATTACGAGAGAGCATATTACTCTGAATATGCTGTTGGGTTTTCT
GGTGTCCTTTTTGCCATGAAAGTTGTTCTCAATTCTCGGTCTGAAGACTA
TACTAACGTACATGGGCTGTTGGTACCGGCACGATATGCTGCTTGGGCAG
AGTTGATTATTATTCAGATGTTTGTGCCTGGTGTCTCCTTTCTTGGTCAT
CTTGGTGGTATACTTGCTGGGATTCTGTATTTGAAGTTGAAAGGTGGTTA
TTCGGGTTCAGACCCGCTGACTACATCA
back to top