CX296880

Overview
NameCX296880
Unique NameCX296880
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length679
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX296880 vs. ExPASy Swiss-Prot
Match: WRK17_ARATH (Probable WRKY transcription factor 17 OS=Arabidopsis thaliana GN=WRKY17 PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 2.283e-26
Identity = 58/80 (72.50%), Postives = 69/80 (86.25%), Query Frame = 3
Query:  153 MAVELMGFPKRMMEDQTAIQEAATQGIKSMEHLIRLMSHHQSSNHVDCSDLTDLTVSKFKKVISLLNRTGHARFRRGPVH 392
            M V++M  PK  MEDQTAIQEAA+QG+KSMEHLIR++S+     +VDCS++TD TVSKFKKVISLLNR+GHARFRRGPVH
Sbjct:    1 MTVDIMRLPK--MEDQTAIQEAASQGLKSMEHLIRVLSNRPEERNVDCSEITDFTVSKFKKVISLLNRSGHARFRRGPVH 78          
BLAST of CX296880 vs. ExPASy Swiss-Prot
Match: WRK11_ARATH (Probable WRKY transcription factor 11 OS=Arabidopsis thaliana GN=WRKY11 PE=1 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 1.133e-25
Identity = 59/81 (72.84%), Postives = 70/81 (86.42%), Query Frame = 3
Query:  153 MAVELMGFPKRMMEDQTAIQEAATQGIKSMEHLIRLMSHHQSSNH-VDCSDLTDLTVSKFKKVISLLNRTGHARFRRGPVH 392
            MAV+LM FPK  ++DQTAIQEAA+QG++SMEHLIR++S+     H VDCS++TD TVSKFK VISLLNRTGHARFRRGPVH
Sbjct:    1 MAVDLMRFPK--IDDQTAIQEAASQGLQSMEHLIRVLSNRPEQQHNVDCSEITDFTVSKFKTVISLLNRTGHARFRRGPVH 79          
The following BLAST results are available for this feature:
BLAST of CX296880 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
WRK17_ARATH2.283e-2672.50Probable WRKY transcription factor 17 OS=Arabidops... [more]
WRK11_ARATH1.133e-2572.84Probable WRKY transcription factor 11 OS=Arabidops... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05803H01SK FerrChloL1 Citrus clementina cDNA clone C05803H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296880 ID=CX296880; Name=CX296880; organism=Citrus clementina; type=EST; length=679bp
GAGGCCTCGTGCCGAATTCGGCACGAGGAGCCTCCACCCTCGCAGCCTCA
GCCTTAAGTTTTACTTTTTCAAAGGGTTTCGTCGAATGACATCTTGAGGC
TTTTCCAAATTGCTCTCCTTTGGTAGCAGAAACTTTTTCGTTTTTCTAAA
TCATGGCGGTGGAGCTGATGGGATTTCCAAAAAGGATGATGGAAGATCAG
ACGGCGATACAAGAAGCTGCAACGCAAGGGATCAAAAGCATGGAGCACCT
GATCCGTCTCATGTCTCATCACCAATCCTCGAATCACGTTGACTGCTCGG
ACCTCACCGATCTCACCGTCTCTAAGTTCAAAAAAGTCATTTCCCTGCTC
AACCGAACCGGTCACGCCCGGTTCAGGCGCGGGCCGGTTCACTCTTCGCC
TTCATCTTCATCTGCATCTGCGCCAGCCGCCGCCGCCTCAGGCAACTCTC
CGCACACACAGACCTTAACTCTTACTCCGCCTGCTCCTACGATGGCTGTC
GCTCCCTCTACGGCGAGTTACGTCCAGTCCCCAGCCGCACAGCCTGACTC
TTGATTTTACAAAACCTAGTTTGTTTAGCGGAAACGTCAAGAGCACTGAG
CTCGAGTTTTCCAAAGACAGCTTCTGTGTGTCGTCGAACTCGTCCTTCAT
GTCCTCTGCTATCACCGGAGACGGCAGCG
back to top