CX296885

Overview
NameCX296885
Unique NameCX296885
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length622
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14514 contig Ccv1_Contig14514:197..818. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296885 vs. ExPASy Swiss-Prot
Match: C71DB_LOTJA (Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 3.900e-43
Identity = 75/113 (66.37%), Postives = 96/113 (84.96%), Query Frame = -1
Query:  281 GPPLPAKARVIVNSWATGRDPMYWTEPESFIPERFIDHSVDYKGTNFEYIPFGAGRRICPGMSFGLASVELTLAMLLYHFEWKLPNGMKHEDLDMTEAFGATVRRKQDLCMIP 619
            G  +PAK+ V+VN++A G D  YW EPE F PERFID S+DYKGTNFE++PFGAGRRICPG+++G+A+VEL LA+LLYHF+W LP G+K+EDLD+TE FG TV +K+DLC+IP
Sbjct:  369 GYHIPAKSTVLVNTFAIGTDSKYWAEPERFCPERFIDSSIDYKGTNFEHLPFGAGRRICPGINYGMANVELVLALLLYHFDWTLPKGIKNEDLDLTEEFGVTVSKKEDLCLIP 481          
BLAST of CX296885 vs. ExPASy Swiss-Prot
Match: C71DA_SOYBN (Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 5.632e-42
Identity = 72/114 (63.16%), Postives = 97/114 (85.09%), Query Frame = -1
Query:  278 GPPLPAKARVIVNSWATGRDPMYWTEPESFIPERFIDHSVDYKGTNFEYIPFGAGRRICPGMSFGLASVELTLAMLLYHFEWKLPNGMKHEDLDMTEAFGATVRRKQDLCMIPI 619
            G  +P+K R+I+N+WA GR+P YW E ESF PERF++ S+D++GT+FE+IPFGAGRRICPG++F + ++EL LA LLYHF+WKLPN MK+E+LDMTE+ G T+RR+ DLC+IPI
Sbjct:  393 GYEIPSKTRIIINAWAIGRNPKYWGETESFKPERFLNSSIDFRGTDFEFIPFGAGRRICPGITFAIPNIELPLAQLLYHFDWKLPNKMKNEELDMTESNGITLRRQNDLCLIPI 506          
BLAST of CX296885 vs. ExPASy Swiss-Prot
Match: C71D9_SOYBN (Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.639e-41
Identity = 75/113 (66.37%), Postives = 92/113 (81.42%), Query Frame = -1
Query:  281 GPPLPAKARVIVNSWATGRDPMYWTEPESFIPERFIDHSVDYKGTNFEYIPFGAGRRICPGMSFGLASVELTLAMLLYHFEWKLPNGMKHEDLDMTEAFGATVRRKQDLCMIP 619
            G  +PAK+RVIVN+WA GRDP  WTE E F PERFI+ S++YK  +FE+IPFGAGRR+CPG++FGL++VE  LAML+YHF+WKLP G K+EDL MTE FG TV RK DL +IP
Sbjct:  379 GYHIPAKSRVIVNAWAIGRDPRLWTEAERFYPERFIERSIEYKSNSFEFIPFGAGRRMCPGLTFGLSNVEYVLAMLMYHFDWKLPKGTKNEDLGMTEIFGITVARKDDLYLIP 491          
BLAST of CX296885 vs. ExPASy Swiss-Prot
Match: C71D8_SOYBN (Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.812e-40
Identity = 73/113 (64.60%), Postives = 90/113 (79.65%), Query Frame = -1
Query:  281 GPPLPAKARVIVNSWATGRDPMYWTEPESFIPERFIDHSVDYKGTNFEYIPFGAGRRICPGMSFGLASVELTLAMLLYHFEWKLPNGMKHEDLDMTEAFGATVRRKQDLCMIP 619
            G  +P K +V++N+WA GRDP YW++ + FIPERF D S+D+KG +FEYIPFGAGRR+CPGM+FGLAS+ L LA+LLYHF W+LPN MK EDLDM E FG TV RK  L +IP
Sbjct:  386 GYEIPIKTKVMINTWAIGRDPQYWSDADRFIPERFNDSSIDFKGNSFEYIPFGAGRRMCPGMTFGLASITLPLALLLYHFNWELPNKMKPEDLDMDEHFGMTVARKNKLFLIP 498          
BLAST of CX296885 vs. ExPASy Swiss-Prot
Match: C71D7_SOLCH (Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.215e-38
Identity = 72/116 (62.07%), Postives = 87/116 (75.00%), Query Frame = -1
Query:  272 GPPLPAKARVIVNSWATGRDPMYWTEPESFIPERFIDHSVDYKGTNFEYIPFGAGRRICPGMSFGLASVELTLAMLLYHFEWKLPNGMKHEDLDMTEAFGATVRRKQDLCMIPIPH 619
            G  +P K +V+VN WA GRDP YW + ESF PERF   S+D+ G NFEY+PFG GRRICPG+SFGLA+V L LA LLYHF+WKLP GM+ +DLD+TE+ G T  RK DL +I  PH
Sbjct:  383 GYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSIDFIGNNFEYLPFGGGRRICPGISFGLANVYLPLAQLLYHFDWKLPTGMEPKDLDLTESAGITAARKGDLYLIATPH 498          
BLAST of CX296885 vs. ExPASy Swiss-Prot
Match: C71DI_MENSP (Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 5.455e-37
Identity = 66/113 (58.41%), Postives = 87/113 (76.99%), Query Frame = -1
Query:  281 GPPLPAKARVIVNSWATGRDPMYWTEPESFIPERFIDHSVDYKGTNFEYIPFGAGRRICPGMSFGLASVELTLAMLLYHFEWKLPNGMKHEDLDMTEAFGATVRRKQDLCMIP 619
            G  +PAK R+ +N WA GRDP YW +P++F PERF + S D+ G +FE+IPFGAGRRICPG+ FGLA+VE+ LA LLYHF+WKLP GM   DLDMTE  G +  +K+++C++P
Sbjct:  378 GYTIPAKTRIFINVWAIGRDPQYWEDPDTFRPERFDEVSRDFMGNDFEFIPFGAGRRICPGLHFGLANVEIPLAQLLYHFDWKLPQGMTDADLDMTETPGLSGPKKKNVCLVP 490          
BLAST of CX296885 vs. ExPASy Swiss-Prot
Match: C71DI_MENGR (Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 5.455e-37
Identity = 66/113 (58.41%), Postives = 87/113 (76.99%), Query Frame = -1
Query:  281 GPPLPAKARVIVNSWATGRDPMYWTEPESFIPERFIDHSVDYKGTNFEYIPFGAGRRICPGMSFGLASVELTLAMLLYHFEWKLPNGMKHEDLDMTEAFGATVRRKQDLCMIP 619
            G  +PAK R+ +N WA GRDP YW +P++F PERF + S D+ G +FE+IPFGAGRRICPG+ FGLA+VE+ LA LLYHF+WKLP GM   DLDMTE  G +  +K+++C++P
Sbjct:  378 GYTIPAKTRIFINVWAIGRDPQYWEDPDTFRPERFDEVSRDFMGNDFEFIPFGAGRRICPGLHFGLANVEIPLAQLLYHFDWKLPQGMTDADLDMTETPGLSGPKKKNVCLVP 490          
BLAST of CX296885 vs. ExPASy Swiss-Prot
Match: C7D95_MENGR (Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 9.305e-37
Identity = 67/116 (57.76%), Postives = 91/116 (78.45%), Query Frame = -1
Query:  272 GPPLPAKARVIVNSWATGRDPMYWTEPESFIPERFIDHSVDYKGTNFEYIPFGAGRRICPGMSFGLASVELTLAMLLYHFEWKLPNGMKHEDLDMTEAFGATVRRKQDLCMIPIPH 619
            G  +P KAR+++N W+ GR+P+YW +PE+F PERF   S D+ G++FE+IPFGAGRRICPG++FGLA+VE+ LA LLYHF+WKL  GMK  D+DM+EA G T  RK +L ++P P+
Sbjct:  378 GYKIPNKARIMINVWSMGRNPLYWEKPETFWPERFDQVSRDFMGSDFEFIPFGAGRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMKPSDMDMSEAEGLTGIRKNNLLLVPTPY 493          
BLAST of CX296885 vs. ExPASy Swiss-Prot
Match: C71DD_MENPI (Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 4.618e-36
Identity = 66/116 (56.90%), Postives = 89/116 (76.72%), Query Frame = -1
Query:  272 GPPLPAKARVIVNSWATGRDPMYWTEPESFIPERFIDHSVDYKGTNFEYIPFGAGRRICPGMSFGLASVELTLAMLLYHFEWKLPNGMKHEDLDMTEAFGATVRRKQDLCMIPIPH 619
            G  +P KAR+++N W+ GR+P+YW +PE+F PERF   S D+ G +FE+IPFGAGRRICPG++FGLA+VE+ LA LLYHF+WKL  GM   D+DM+EA G T  RK +L ++P P+
Sbjct:  381 GYTIPNKARIMINVWSMGRNPLYWEKPETFWPERFDQVSRDFMGNDFEFIPFGAGRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMNPSDMDMSEAEGLTGIRKNNLLLVPTPY 496          
BLAST of CX296885 vs. ExPASy Swiss-Prot
Match: C7D95_MENSP (Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 7.877e-36
Identity = 66/113 (58.41%), Postives = 89/113 (78.76%), Query Frame = -1
Query:  281 GPPLPAKARVIVNSWATGRDPMYWTEPESFIPERFIDHSVDYKGTNFEYIPFGAGRRICPGMSFGLASVELTLAMLLYHFEWKLPNGMKHEDLDMTEAFGATVRRKQDLCMIP 619
            G  +P KAR+++N W+ GR+P+YW +PE+F PERF   S D+ G++FE+IPFGAGRRICPG++FGLA+VE+ LA LLYHF+WKL  GMK  D+DM+EA G T  RK +L ++P
Sbjct:  378 GYKIPNKARIMINVWSMGRNPLYWEKPETFWPERFDQVSRDFMGSDFEFIPFGAGRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMKPSDMDMSEAEGLTGIRKNNLLLVP 490          
The following BLAST results are available for this feature:
BLAST of CX296885 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 140
Match NameE-valueIdentityDescription
C71DB_LOTJA3.900e-4366.37Cytochrome P450 71D11 (Fragment) OS=Lotus japonicu... [more]
C71DA_SOYBN5.632e-4263.16Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 P... [more]
C71D9_SOYBN1.639e-4166.37Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=... [more]
C71D8_SOYBN1.812e-4064.60Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=... [more]
C71D7_SOLCH2.215e-3862.07Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71... [more]
C71DI_MENSP5.455e-3758.41Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D1... [more]
C71DI_MENGR5.455e-3758.41Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D... [more]
C7D95_MENGR9.305e-3757.76Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D... [more]
C71DD_MENPI4.618e-3656.90Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D... [more]
C7D95_MENSP7.877e-3658.41Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D9... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05803H06SK FerrChloL1 Citrus clementina cDNA clone C05803H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296885 ID=CX296885|Name=CX296885|organism=Citrus clementina|type=EST|length=622bp
TTTATTATCAAATACACACATAATGTGTGGTGAATTATTTCTTATATACA
AGTGCTGAAGCTCAGCTTGATTACTGTTATTAGTCACTAAACTATTAACA
AACTATATTAAGCTGAACATAACAACTTTAACTAATCAATCACGTGTACA
CATAATTTCATAATCACCAGGCATGACGTGGCATGCCACATCATCAATGT
GTAACTGATTGATCCTGCTACTATCATCCTCTGCTCTGCTGACTACACTA
CAAGTGTGAGCTTCCTTAACAGTGTGGAATAGGAATCATGCACAGATCTT
GTTTTCTTCTTACTGTCGCGCCAAAGGCCTCTGTCATGTCCAAATCCTCA
TGCTTCATTCCATTTGGTAGTTTCCATTCGAAATGGTATAATAACATCGC
GAGTGTAAGCTCCACGCTGGCCAGACCAAATGACATTCCAGGGCATATCC
TCCTACCAGCACCAAATGGGATGTACTCAAAATTAGTCCCCTTGTAGTCA
ACAGAATGGTCAATGAATCTCTCGGGAATAAAGCTCTCAGGTTCAGTCCA
ATACATGGGATCTCTTCCAGTTGCCCATGAATTAACAATGACTCTGGCTT
TTGCAGGAAGGGGGGGCCCGGT
back to top