CX296886

Overview
NameCX296886
Unique NameCX296886
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length720
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11358 contig Ccv1_Contig11358:89..808. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296886 vs. ExPASy Swiss-Prot
Match: WRK31_ARATH (Probable WRKY transcription factor 31 OS=Arabidopsis thaliana GN=WRKY31 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.712e-30
Identity = 79/134 (58.96%), Postives = 97/134 (72.39%), Query Frame = 1
Query:  307 RVAVDEVDFFSDDKNRVSISDHREDDRNKTTNSVHIKKENSHDQLRHRTGLDVNTGLHLLTAANTGSDQSTVDDGVSSDHADKKRTKIELTQLQVELQQMNTENQRLRDMLSQVTNNYNALQMHIVALMQQQQE 708
            RV VDEVDFFS+ ++RVS  +  +DD     N V IK E S  +   R+  DVN GL+LLTA NTGSD+STVDDG+S D  DK R KIE  QLQ EL++M  ENQRLRDMLSQ T N+NALQM +VA+M+QQ++
Sbjct:   27 RVVVDEVDFFSEKRDRVSRENINDDDDEG--NKVLIKMEGSRVEENDRSR-DVNIGLNLLTA-NTGSDESTVDDGLSMDMEDK-RAKIENAQLQEELKKMKIENQRLRDMLSQATTNFNALQMQLVAVMRQQEQ 155          
BLAST of CX296886 vs. ExPASy Swiss-Prot
Match: WRK42_ARATH (Probable WRKY transcription factor 42 OS=Arabidopsis thaliana GN=WRKY42 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 7.442e-26
Identity = 66/135 (48.89%), Postives = 94/135 (69.63%), Query Frame = 1
Query:  307 RVAVDEVDFFSDDKNRVSISDHREDDRNKTTNSVHIKKENSH-DQLRHRTGLDVNTGLHLLTAANTGSDQSTVDDGVSSDHADKKRTKIELTQLQVELQQMNTENQRLRDMLSQVTNNYNALQMHIVALMQQQQE 708
            R  V+EVDFF   + R  +S   ++     T+ VH+K+ENS  D    R+   +N GL+LLTA NTGSD+S VDDG+S D  ++KRTK E  QL+ EL++ + +NQRL+ MLSQ TNN+N+LQM +VA+M+QQ++
Sbjct:   25 RAVVNEVDFFRSAEKRDRVSREEQNIIADETHRVHVKRENSRVDDHDDRSTDHINIGLNLLTA-NTGSDESMVDDGLSVD-MEEKRTKCENAQLREELKKASEDNQRLKQMLSQTTNNFNSLQMQLVAVMRQQED 157          
BLAST of CX296886 vs. ExPASy Swiss-Prot
Match: WRKY6_ARATH (WRKY transcription factor 6 OS=Arabidopsis thaliana GN=WRKY6 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.269e-25
Identity = 86/218 (39.45%), Postives = 115/218 (52.75%), Query Frame = 1
Query:   94 MDKGW-GLTLDSDHPIVSNLNFFTSNKPKP-----SLARFRTNRDMXXXXXXXXXXVRMFQLXXXXXXXXXXXXXXXRVAVD-------EVDFFSDDKNRVSISDHREDDRNKTTNSVHIKKENSHDQLRHRTGLDVNTGLHLLTAANTGSDQSTVDDGVSSDHADKKRTKIELTQLQVELQQMNTENQRLRDMLSQVTNNYNALQMHIVALMQQQQE 708
            MD+GW GLTLDS    + N N  +    +      +++R     D            R F +                VA D       EVDFFSD K+RV     REDD         +KKE   D+       DVNTGL+L T  NT SD+S +DDG SS+  DK R K EL +LQ EL++M  +NQ+LR++L+QV+N+Y +LQMH+V+LMQQQQ+
Sbjct:    1 MDRGWSGLTLDSSSLDLLNPNRISHKNHRRFSNPLAMSRIDEEDDQKTRISTNGSEFR-FPVSLSGIRDREDEDFSSGVAGDNDREVPGEVDFFSDKKSRVC----REDDEG-----FRVKKEEQDDRT------DVNTGLNLRTTGNTKSDESMIDDGESSEMEDK-RAKNELVKLQDELKKMTMDNQKLRELLTQVSNSYTSLQMHLVSLMQQQQQ 201          
The following BLAST results are available for this feature:
BLAST of CX296886 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
WRK31_ARATH1.712e-3058.96Probable WRKY transcription factor 31 OS=Arabidops... [more]
WRK42_ARATH7.442e-2648.89Probable WRKY transcription factor 42 OS=Arabidops... [more]
WRKY6_ARATH1.269e-2539.45WRKY transcription factor 6 OS=Arabidopsis thalian... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05803H07SK FerrChloL1 Citrus clementina cDNA clone C05803H07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296886 ID=CX296886|Name=CX296886|organism=Citrus clementina|type=EST|length=720bp
CTCTCTCTCGATTCGTTCCACTTTCTCTTCTAAATCTTCCCTTCTTTTGC
TTTTGCTTTTGCTTAATTAATTTTCTTCAATTTAATTATATTTATGGACA
AAGGATGGGGTCTCACACTTGATTCTGATCATCCTATTGTTAGTAATCTG
AATTTCTTCACAAGCAACAAGCCAAAGCCATCATTAGCAAGGTTTAGAAC
AAACCGTGACATGGCTGCTTCTGGTGCTGCTGACTCAGCTTCTGTCAGAA
TGTTTCAGCTTCCGGCCTCCGACAATAGTAATGCTCCCTCCTCGTCTGAT
GATAATCGGGTGGCTGTTGATGAAGTTGACTTCTTTTCCGATGACAAGAA
CAGAGTTTCTATCTCTGATCATCGTGAAGATGATCGTAACAAGACAACAA
ATTCTGTTCACATCAAGAAAGAGAATTCTCACGACCAACTTCGTCACAGA
ACTGGCTTGGATGTTAATACTGGCTTGCATCTACTTACTGCTGCTAACAC
TGGAAGCGATCAATCAACGGTTGATGATGGGGTTTCATCTGATCATGCTG
ACAAAAAACGAACAAAAATTGAGTTGACTCAATTGCAAGTGGAGCTGCAA
CAAATGAATACAGAAAATCAAAGGTTAAGAGACATGCTTAGCCAAGTAAC
TAACAATTACAATGCACTACAGATGCATATTGTTGCATTAATGCAACAGC
AGCAAGAAATCGCCGAGCCC
back to top