CX296887

Overview
NameCX296887
Unique NameCX296887
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX296887 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 8.964e-93
Identity = 164/213 (77.00%), Postives = 180/213 (84.51%), Query Frame = 3
Query:   51 IGVKEMLGNPLNVSSAVRTSAPGASNPSTFKPVALFXXXXXXXXXXXXXXXXXXXNEELAKWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVFAVIAEIVLVGGAEYYRITNGLDLEDKLHPGGPFDPLGLAR 689
            +GV EMLG PLN  +  R+SAP AS+PSTFK VALF                   ++ELAKWYGPDRRIFLP+GLLDRSEIPEYL GEV GDYGYDPFGL KKP++F+KYQA+ELIHARWAMLGAAGFIIPEA NK+GANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLV AV+AE+VL+GGAEYYRITNGLD EDKLHPGGPFDPLGLA+
Sbjct:    4 LGVSEMLGTPLNFRAVSRSSAPLASSPSTFKTVALFSKKKPAPAKSKAVSET---SDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAK 213          
BLAST of CX296887 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.231e-33
Identity = 76/159 (47.80%), Postives = 98/159 (61.64%), Query Frame = 3
Query:  231 KWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPI---NLVFAVIAEIVLVGGAEYYRITNG----LDLEDKLHPGGPFDPLGLA 686
            ++YGPDR  FL  G    ++ PEYLTGE PGDYG+D  GLS  P  F++Y+  ELIHARWA+LGA G + PE  +++      E VWFK GA +     LNY G    I   +++  +  ++VL+G AE YR   G    LD  D L+PGGPFDPLGLA
Sbjct:   32 EFYGPDRAKFL--GPFSENDTPEYLTGEFPGDYGWDTAGLSADPQTFARYREIELIHARWALLGALGILTPELLSQYAGVQFGEPVWFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQVVLMGLAEAYRANGGSEGFLDDLDTLYPGGPFDPLGLA 188          
BLAST of CX296887 vs. ExPASy Swiss-Prot
Match: CB22_MAIZE (Chlorophyll a-b binding protein, chloroplastic OS=Zea mays PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.274e-30
Identity = 76/156 (48.72%), Postives = 96/156 (61.54%), Query Frame = 3
Query:  234 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLA 686
            WYGPDR ++L  G L   E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE   + G   G EAVWFK G+ +     L+Y G    I    + A+ A ++VL+G  E YRI  G   ++ D L+PGG FDPLGLA
Sbjct:   49 WYGPDRVLYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLA 200          
BLAST of CX296887 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.664e-30
Identity = 72/156 (46.15%), Postives = 95/156 (60.90%), Query Frame = 3
Query:  234 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLA 686
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P++F+K +  E+IH RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G    +    + A+ A +++L+G  E YRI  G   ++ D ++PGG FDPLGLA
Sbjct:   58 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLA 209          
BLAST of CX296887 vs. ExPASy Swiss-Prot
Match: CB29_MAIZE (Chlorophyll a-b binding protein M9, chloroplastic OS=Zea mays GN=CAB-M9 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.664e-30
Identity = 75/156 (48.08%), Postives = 97/156 (62.18%), Query Frame = 3
Query:  234 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLA 686
            WYGPDR ++L  G L   E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK G+ +     L+Y G    I    + A+ A ++VL+G  E YR+  G   ++ D L+PGG FDPLGLA
Sbjct:   49 WYGPDRVLYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVVDPLYPGGTFDPLGLA 200          
BLAST of CX296887 vs. ExPASy Swiss-Prot
Match: CB28_PEA (Chlorophyll a-b binding protein 8, chloroplastic OS=Pisum sativum GN=CAB8 PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.174e-30
Identity = 73/156 (46.79%), Postives = 95/156 (60.90%), Query Frame = 3
Query:  234 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLA 686
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ FSK +  E+IH+RWAMLGA G + PE  ++ G   G EAVWFK G+ +     L+Y G    +    + A+ A +++L+G  E YRI  G   ++ D L+PGG FDPLGLA
Sbjct:   52 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLA 203          
BLAST of CX296887 vs. ExPASy Swiss-Prot
Match: CB22_PEA (Chlorophyll a-b binding protein AB80, chloroplastic OS=Pisum sativum GN=AB80 PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.174e-30
Identity = 73/156 (46.79%), Postives = 95/156 (60.90%), Query Frame = 3
Query:  234 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLA 686
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ FSK +  E+IH+RWAMLGA G + PE  ++ G   G EAVWFK G+ +     L+Y G    +    + A+ A +++L+G  E YRI  G   ++ D L+PGG FDPLGLA
Sbjct:   53 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLA 204          
BLAST of CX296887 vs. ExPASy Swiss-Prot
Match: CB24_PETSP (Chlorophyll a-b binding protein 25, chloroplastic OS=Petunia sp. GN=CAB25 PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.839e-30
Identity = 73/156 (46.79%), Postives = 94/156 (60.26%), Query Frame = 3
Query:  234 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLA 686
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE F + G   G EAVWFK G+ +     L+Y G    +    + A+ A ++VL+G  E YR+  G   ++ D L+PGG FDPLGLA
Sbjct:   50 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLA 201          
BLAST of CX296887 vs. ExPASy Swiss-Prot
Match: CB2A_PINSY (Chlorophyll a-b binding protein type 2 member 1A, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.708e-30
Identity = 72/156 (46.15%), Postives = 96/156 (61.54%), Query Frame = 3
Query:  234 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG--KNIPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLA 686
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G  + I    + A+ A +++L+G  E YR+  G   ++ D ++PGG FDPLGLA
Sbjct:   62 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLA 213          
BLAST of CX296887 vs. ExPASy Swiss-Prot
Match: CB21_MAIZE (Chlorophyll a-b binding protein 1, chloroplastic OS=Zea mays GN=CAB1 PE=3 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.708e-30
Identity = 74/156 (47.44%), Postives = 95/156 (60.90%), Query Frame = 3
Query:  234 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLA 686
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE  ++ G   G EAVWFK G+ +     L+Y G    I    + A+ A ++VL+G  E YRI  G   ++ D L+PGG FDPLGLA
Sbjct:   46 WYGPDRVKYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLA 197          
The following BLAST results are available for this feature:
BLAST of CX296887 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 68
Match NameE-valueIdentityDescription
CB26_ARATH8.964e-9377.00Chlorophyll a-b binding protein CP26, chloroplasti... [more]
CB2_DUNTE1.231e-3347.80Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB22_MAIZE1.274e-3048.72Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB2B_PINSY1.664e-3046.15Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB29_MAIZE1.664e-3048.08Chlorophyll a-b binding protein M9, chloroplastic ... [more]
CB28_PEA2.174e-3046.79Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB22_PEA2.174e-3046.79Chlorophyll a-b binding protein AB80, chloroplasti... [more]
CB24_PETSP2.839e-3046.79Chlorophyll a-b binding protein 25, chloroplastic ... [more]
CB2A_PINSY3.708e-3046.15Chlorophyll a-b binding protein type 2 member 1A, ... [more]
CB21_MAIZE3.708e-3047.44Chlorophyll a-b binding protein 1, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05803H08SK FerrChloL1 Citrus clementina cDNA clone C05803H08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296887 ID=CX296887; Name=CX296887; organism=Citrus clementina; type=EST; length=707bp
GAGGTCTGAAGATGGCTTCATTGGCAGCATCGTCCACTCCTGCTGCCTCC
ATTGGAGTTAAGGAGATGCTTGGCAACCCTCTCAATGTCAGCAGTGCTGT
TAGGACTTCAGCTCCAGGTGCATCAAACCCTTCTACTTTCAAGCCCGTTG
CTCTCTTCTCCAAGAAGAAAGCCGCCCCTCCTGCCAAGTCTAAGCCCGTC
GCCGTCTCCCCCGTTAACGAAGAGCTCGCCAAGTGGTATGGTCCTGACCG
AAGAATTTTCTTGCCCGAGGGTCTCTTGGACAGATCTGAGATCCCTGAGT
ACTTGACCGGAGAAGTTCCCGGAGACTATGGTTACGATCCTTTTGGTCTC
AGCAAGAAACCAGACGACTTCAGCAAATATCAGGCATATGAATTGATTCA
TGCCAGATGGGCCATGCTTGGTGCTGCTGGTTTCATCATTCCTGAAGCCT
TTAACAAGTTTGGTGCTAACTGTGGTCCTGAAGCTGTCTGGTTCAAGACT
GGAGCTCTACTTCTTGATGGAAACACATTGAACTACTTCGGAAAGAACAT
CCCAATCAACCTTGTTTTTGCTGTCATTGCTGAGATTGTTCTTGTAGGTG
GTGCTGAATATTATAGAATCACCAACGGTTTGGATTTGGAGGACAAGCTT
CACCCAGGTGGTCCATTTGACCCACTGGGATTAGCAAGGATCCTGACAAT
TTGCATT
back to top