CX298531
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX298531 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1) HSP 1 Score: 52.7582 bits (125), Expect = 1.449e-14 Identity = 25/37 (67.57%), Postives = 28/37 (75.68%), Query Frame = -2 Query: 387 ICVL*YVPYVGDGKRAIDEYTSEIFMEAKTPFCGHNT 497 I V+ YVPYVGD KRA+DEYTSEIFM K+ HNT Sbjct: 383 IVVIKYVPYVGDSKRAMDEYTSEIFMGGKSTIVLHNT 419 HSP 2 Score: 45.8246 bits (107), Expect = 1.449e-14 Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = -1 Query: 223 KAE*EGEFHSFRPVATILTFFTKAPL-DQLTPCISFISLQ 339 KAE EG+FHSF PVATIL++ TKAPL TP ++ +S Q Sbjct: 446 KAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQ 485
BLAST of CX298531 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1) HSP 1 Score: 52.373 bits (124), Expect = 1.449e-14 Identity = 24/37 (64.86%), Postives = 27/37 (72.97%), Query Frame = -2 Query: 387 ICVL*YVPYVGDGKRAIDEYTSEIFMEAKTPFCGHNT 497 + V+ YVPYVGD KRA+DEYTSEIFM K HNT Sbjct: 383 VVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVMHNT 419 HSP 2 Score: 46.2098 bits (108), Expect = 1.449e-14 Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = -1 Query: 223 KAE*EGEFHSFRPVATILTFFTKAPLDQL-TPCISFISLQ 339 KAE EG+FHSF PVATIL++ TKAPL TP ++ +S Q Sbjct: 446 KAEGEGKFHSFHPVATILSYLTKAPLVPAGTPVVNALSKQ 485
BLAST of CX298531 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 51.9878 bits (123), Expect = 2.446e-14 Identity = 24/37 (64.86%), Postives = 27/37 (72.97%), Query Frame = -2 Query: 387 ICVL*YVPYVGDGKRAIDEYTSEIFMEAKTPFCGHNT 497 + V+ YVPYVGD KRA+DEYTSEIFM K HNT Sbjct: 383 VVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNT 419 HSP 2 Score: 45.8246 bits (107), Expect = 2.446e-14 Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = -1 Query: 223 KAE*EGEFHSFRPVATILTFFTKAPL-DQLTPCISFISLQ 339 KAE EG+FHSF PVATIL++ TKAPL TP ++ +S Q Sbjct: 446 KAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQ 485
BLAST of CX298531 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1) HSP 1 Score: 51.9878 bits (123), Expect = 2.446e-14 Identity = 24/37 (64.86%), Postives = 27/37 (72.97%), Query Frame = -2 Query: 387 ICVL*YVPYVGDGKRAIDEYTSEIFMEAKTPFCGHNT 497 + V+ YVPYVGD KRA+DEYTSEIFM K HNT Sbjct: 383 VVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNT 419 HSP 2 Score: 45.8246 bits (107), Expect = 2.446e-14 Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = -1 Query: 223 KAE*EGEFHSFRPVATILTFFTKAPL-DQLTPCISFISLQ 339 KAE EG+FHSF PVATIL++ TKAPL TP ++ +S Q Sbjct: 446 KAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQ 485
BLAST of CX298531 vs. ExPASy Swiss-Prot
Match: INO1_PHAVU (Inositol-3-phosphate synthase OS=Phaseolus vulgaris PE=2 SV=1) HSP 1 Score: 50.0618 bits (118), Expect = 1.527e-13 Identity = 23/37 (62.16%), Postives = 26/37 (70.27%), Query Frame = -2 Query: 387 ICVL*YVPYVGDGKRAIDEYTSEIFMEAKTPFCGHNT 497 + V+ YVPYV D KRA+DEYTSEIFM K HNT Sbjct: 384 VVVIKYVPYVADSKRAMDEYTSEIFMGGKNTIVMHNT 420 HSP 2 Score: 45.0542 bits (105), Expect = 1.527e-13 Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = -1 Query: 223 KAE*EGEFHSFRPVATILTFFTKAPL-DQLTPCISFISLQ 339 K+E EG+FHSF PVATIL++ TKAPL TP I+ +S Q Sbjct: 447 KSEGEGKFHSFHPVATILSYLTKAPLVPPGTPVINALSKQ 486
BLAST of CX298531 vs. ExPASy Swiss-Prot
Match: INO1_ARATH (Inositol-3-phosphate synthase isozyme 1 OS=Arabidopsis thaliana GN=At4g39800 PE=2 SV=3) HSP 1 Score: 50.0618 bits (118), Expect = 1.527e-13 Identity = 23/37 (62.16%), Postives = 26/37 (70.27%), Query Frame = -2 Query: 387 ICVL*YVPYVGDGKRAIDEYTSEIFMEAKTPFCGHNT 497 + V+ YVPYV D KRA+DEYTSEIFM K HNT Sbjct: 384 VVVIKYVPYVADSKRAMDEYTSEIFMGGKNTIVMHNT 420 HSP 2 Score: 45.0542 bits (105), Expect = 1.527e-13 Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = -1 Query: 223 KAE*EGEFHSFRPVATILTFFTKAPL-DQLTPCISFISLQ 339 K+E EG+FHSF PVATIL++ TKAPL TP I+ +S Q Sbjct: 447 KSEGEGKFHSFHPVATILSYLTKAPLVPPGTPVINALSKQ 486
BLAST of CX298531 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2) HSP 1 Score: 48.521 bits (114), Expect = 2.577e-13 Identity = 22/37 (59.46%), Postives = 26/37 (70.27%), Query Frame = -2 Query: 387 ICVL*YVPYVGDGKRAIDEYTSEIFMEAKTPFCGHNT 497 + V+ YVPYV D KRA+DEYTSEIFM + HNT Sbjct: 383 VVVIKYVPYVADSKRAMDEYTSEIFMGGRNTIVLHNT 419 HSP 2 Score: 45.8246 bits (107), Expect = 2.577e-13 Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = -1 Query: 223 KAE*EGEFHSFRPVATILTFFTKAPL-DQLTPCISFISLQ 339 KAE EG+FHSF PVATIL++ TKAPL TP ++ +S Q Sbjct: 446 KAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQ 485
BLAST of CX298531 vs. ExPASy Swiss-Prot
Match: INO1_ORYSJ (Inositol-3-phosphate synthase OS=Oryza sativa subsp. japonica GN=INO1 PE=2 SV=2) HSP 1 Score: 52.373 bits (124), Expect = 3.347e-13 Identity = 24/37 (64.86%), Postives = 28/37 (75.68%), Query Frame = -2 Query: 387 ICVL*YVPYVGDGKRAIDEYTSEIFMEAKTPFCGHNT 497 + V+ YVPYVGD KRA+DEYTSEIFM K+ HNT Sbjct: 383 VVVIKYVPYVGDSKRAMDEYTSEIFMGGKSTIVLHNT 419 HSP 2 Score: 41.5874 bits (96), Expect = 3.347e-13 Identity = 22/40 (55.00%), Postives = 29/40 (72.50%), Query Frame = -1 Query: 223 KAE*EGEFHSFRPVATILTFFTKAPL-DQLTPCISFISLQ 339 KAE E +FHSF PVATIL++ TKAPL TP ++ ++ Q Sbjct: 446 KAEGEEKFHSFHPVATILSYLTKAPLVPPGTPVVNALAKQ 485
BLAST of CX298531 vs. ExPASy Swiss-Prot
Match: INO1_MAIZE (Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=2) HSP 1 Score: 51.9878 bits (123), Expect = 3.347e-13 Identity = 24/37 (64.86%), Postives = 27/37 (72.97%), Query Frame = -2 Query: 387 ICVL*YVPYVGDGKRAIDEYTSEIFMEAKTPFCGHNT 497 + V+ YVPYVGD KRA+DEYTSEIFM K HNT Sbjct: 383 VVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNT 419 HSP 2 Score: 41.9726 bits (97), Expect = 3.347e-13 Identity = 22/40 (55.00%), Postives = 29/40 (72.50%), Query Frame = -1 Query: 223 KAE*EGEFHSFRPVATILTFFTKAPL-DQLTPCISFISLQ 339 KAE E +FHSF PVATIL++ TKAPL TP ++ ++ Q Sbjct: 446 KAEGEDKFHSFHPVATILSYLTKAPLVPPGTPVVNALAKQ 485
BLAST of CX298531 vs. ExPASy Swiss-Prot
Match: INO1_MESCR (Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1) HSP 1 Score: 50.0618 bits (118), Expect = 5.645e-13 Identity = 23/37 (62.16%), Postives = 26/37 (70.27%), Query Frame = -2 Query: 387 ICVL*YVPYVGDGKRAIDEYTSEIFMEAKTPFCGHNT 497 + V+ YVPYVGD KRA+DEYTSEIFM HNT Sbjct: 385 VVVIKYVPYVGDSKRAMDEYTSEIFMGGTNTIVMHNT 421 HSP 2 Score: 43.1282 bits (100), Expect = 5.645e-13 Identity = 23/40 (57.50%), Postives = 29/40 (72.50%), Query Frame = -1 Query: 223 KAE*EGEFHSFRPVATILTFFTKAPL-DQLTPCISFISLQ 339 KAE E +FHSF PVATIL++ TKAPL TP ++ +S Q Sbjct: 448 KAEEEDKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQ 487 The following BLAST results are available for this feature:
BLAST of CX298531 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 14
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX298531 ID=CX298531; Name=CX298531; organism=Citrus clementina; type=EST; length=627bpback to top |