CX299917

Overview
NameCX299917
Unique NameCX299917
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length719
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX299917 vs. ExPASy Swiss-Prot
Match: ADHL7_ARATH (Alcohol dehydrogenase-like 7 OS=Arabidopsis thaliana GN=At5g42250 PE=2 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 3.713e-94
Identity = 164/207 (79.23%), Postives = 184/207 (88.89%), Query Frame = 1
Query:    1 LLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWGKTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFVTHEMKFEEINSAFDLLIKGKCLRCVIWMG 621
            LLSCGVSTGVGAAW TA VE GSTVVIFGLGSIGLAVAEGARLCGA+RIIGVD+   KF++G++FGVTEFVNS  C    VS++I +MTDGGADYCFECVG +SLVQEAYACCR+GWGKTI LGVD+PGSQ+ L SF+VLH GKILMGSLFGGLKAK+ IPILLKRY+  ELELDKFVTHEMKFEEIN AF LL++GKC+RCV+WMG
Sbjct:  184 LLSCGVSTGVGAAWETAKVEKGSTVVIFGLGSIGLAVAEGARLCGASRIIGVDINPTKFQVGQKFGVTEFVNSMTCEKNRVSEVINEMTDGGADYCFECVGSSSLVQEAYACCRQGWGKTITLGVDKPGSQICLDSFDVLHHGKILMGSLFGGLKAKTHIPILLKRYLSNELELDKFVTHEMKFEEINDAFQLLLEGKCIRCVLWMG 390          
BLAST of CX299917 vs. ExPASy Swiss-Prot
Match: ADHL5_ARATH (Alcohol dehydrogenase-like 5 OS=Arabidopsis thaliana GN=At4g22110 PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 8.050e-73
Identity = 130/208 (62.50%), Postives = 167/208 (80.29%), Query Frame = 1
Query:    1 LLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWGKTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFVTHEMKFEEINSAFDLLIKGKCLRCVIWMGE 624
            LLSCGVSTG+GAAW+ ANVE GSTV +FGLG++GLAV EGARL GA +IIGVD+  EKFE+GK+FG T+F+NS  CG+  +S++I +MT GG DY FECVGL SL+ EA++  R G GKT+VLG+D+  + +SL SF++L  G+ + GSLFGGLK K DIPIL+  Y+ KEL LD F+THE+KFEEIN AFDLL++GK LRC++WM +
Sbjct:  183 LLSCGVSTGIGAAWKVANVEKGSTVAVFGLGAVGLAVGEGARLRGAGKIIGVDLNPEKFELGKKFGFTDFINSTLCGENKISEVIKEMTGGGVDYSFECVGLPSLLTEAFSSTRTGSGKTVVLGIDKHLTPVSLGSFDLLR-GRHVCGSLFGGLKPKLDIPILVDHYLKKELNLDSFITHELKFEEINKAFDLLVQGKSLRCILWMNK 389          
BLAST of CX299917 vs. ExPASy Swiss-Prot
Match: ADHL1_ARATH (Alcohol dehydrogenase-like 1 OS=Arabidopsis thaliana GN=At1g22430 PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 3.059e-72
Identity = 126/206 (61.17%), Postives = 167/206 (81.07%), Query Frame = 1
Query:    1 LLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWGKTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFVTHEMKFEEINSAFDLLIKGKCLRCVIWM 618
            LLSCGVSTG+GAAW+ ANVE GST+ IFGLG++GLAVAEGARL GA +IIG+D  S+KFE+GK+FG T+F+N   CG+K +S++I +MT+GG DY FECVGLASL+ EA+   R G GKT++LG+++  + +SL SF++L  G+++ GSLFGGLK+K DIPIL+  Y+ KEL LD F+THE+ F+EIN AF LL +GK LRC++WM
Sbjct:  182 LLSCGVSTGIGAAWKVANVEEGSTIAIFGLGAVGLAVAEGARLRGAAKIIGIDTNSDKFELGKKFGFTDFINPTLCGEKKISEVIKEMTEGGVDYSFECVGLASLLNEAFISTRTGTGKTVMLGMEKHAAPISLGSFDLLR-GRVICGSLFGGLKSKLDIPILVDHYLKKELNLDSFITHELNFKEINKAFALLEEGKSLRCILWM 386          
BLAST of CX299917 vs. ExPASy Swiss-Prot
Match: ADHL2_ARATH (Alcohol dehydrogenase-like 2 OS=Arabidopsis thaliana GN=At1g22440 PE=2 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.088e-69
Identity = 127/206 (61.65%), Postives = 164/206 (79.61%), Query Frame = 1
Query:    1 LLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWGKTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFVTHEMKFEEINSAFDLLIKGKCLRCVIWM 618
            LLSC V+TG+GAAW+ A+VE GSTVVIFGLG++GLAVAEG RL GA +IIGVD+   KFEIGKRFG+T+FVN   CG+K++S++I +MTD GADY FEC+GLASL++EA+   R G GKTIVLG++Q    +SL S+++L  G+ + G+LFGGLK K DIPIL+ RY+ KEL L+  +THE+ FEEIN AF LL +G  +RC+IWM
Sbjct:  180 LLSCSVATGLGAAWKVADVEEGSTVVIFGLGAVGLAVAEGVRLRGAAKIIGVDLNPAKFEIGKRFGITDFVNPALCGEKTISEVIREMTDVGADYSFECIGLASLMEEAFKSTRPGSGKTIVLGMEQKALPISLGSYDLLR-GRTVCGTLFGGLKPKLDIPILVDRYLKKELNLEDLITHELSFEEINKAFHLLAEGNSIRCIIWM 384          
BLAST of CX299917 vs. ExPASy Swiss-Prot
Match: ADHX_ORYSJ (Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. japonica GN=Os02g0815500 PE=2 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 8.921e-64
Identity = 109/204 (53.43%), Postives = 157/204 (76.96%), Query Frame = 1
Query:    1 LLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWGKTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFVTHEMKFEEINSAFDLLIKGKCLRCVI 612
            LL CGVSTG+GA W TA VE GS V IFGLG++GLAVAEGA+  GA+RIIG+D+ S+KF++ K FGVTEFVN K+  DK + Q+I+D+TDGG DY FEC+G  S+++ A  CC KGWG ++++GV   G ++S   F+++ +G++  G+ FGG K++S +P L+++Y++KE+++D++VTH M   +IN AFDLL +G CLRCV+
Sbjct:  176 LLGCGVSTGLGAVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKSAGASRIIGIDIDSKKFDVAKNFGVTEFVNPKD-HDKPIQQVIVDLTDGGVDYSFECIGNVSVMRSALECCHKGWGTSVIVGVAASGQEISTRPFQLV-TGRVWKGTAFGGFKSRSQVPWLVEKYLNKEIKVDEYVTHSMNLTDINKAFDLLHEGGCLRCVL 377          
BLAST of CX299917 vs. ExPASy Swiss-Prot
Match: ADHX_ORYSI (Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. indica GN=ADHIII PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 8.921e-64
Identity = 109/204 (53.43%), Postives = 157/204 (76.96%), Query Frame = 1
Query:    1 LLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWGKTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFVTHEMKFEEINSAFDLLIKGKCLRCVI 612
            LL CGVSTG+GA W TA VE GS V IFGLG++GLAVAEGA+  GA+RIIG+D+ S+KF++ K FGVTEFVN K+  DK + Q+I+D+TDGG DY FEC+G  S+++ A  CC KGWG ++++GV   G ++S   F+++ +G++  G+ FGG K++S +P L+++Y++KE+++D++VTH M   +IN AFDLL +G CLRCV+
Sbjct:  176 LLGCGVSTGLGAVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKSAGASRIIGIDIDSKKFDVAKNFGVTEFVNPKD-HDKPIQQVIVDLTDGGVDYSFECIGNVSVMRSALECCHKGWGTSVIVGVAASGQEISTRPFQLV-TGRVWKGTAFGGFKSRSQVPWLVEKYLNKEIKVDEYVTHSMNLTDINKAFDLLHEGGCLRCVL 377          
BLAST of CX299917 vs. ExPASy Swiss-Prot
Match: ADHX_ARATH (Alcohol dehydrogenase class-3 OS=Arabidopsis thaliana GN=ADH2 PE=1 SV=2)

HSP 1 Score: 236.498 bits (602), Expect = 1.090e-61
Identity = 105/204 (51.47%), Postives = 155/204 (75.98%), Query Frame = 1
Query:    1 LLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWGKTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFVTHEMKFEEINSAFDLLIKGKCLRCVI 612
            LL CGV TG+GA W TA VE GS V IFGLG++GLAVAEGA+  GA+RIIG+D+ S+K+E  K+FGV EFVN K+  DK + ++I+D+TDGG DY FEC+G  S+++ A  CC KGWG ++++GV   G ++S   F+++ +G++  G+ FGG K+++ +P L+++YM+KE+++D+++TH +   EIN AFDLL +G CLRCV+
Sbjct:  174 LLGCGVPTGLGAVWNTAKVEPGSNVAIFGLGTVGLAVAEGAKTAGASRIIGIDIDSKKYETAKKFGVNEFVNPKD-HDKPIQEVIVDLTDGGVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAASGQEISTRPFQLV-TGRVWKGTAFGGFKSRTQVPWLVEKYMNKEIKVDEYITHNLTLGEINKAFDLLHEGTCLRCVL 375          
BLAST of CX299917 vs. ExPASy Swiss-Prot
Match: ADHX_PEA (Alcohol dehydrogenase class-3 OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 5.412e-61
Identity = 105/204 (51.47%), Postives = 154/204 (75.49%), Query Frame = 1
Query:    1 LLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWGKTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFVTHEMKFEEINSAFDLLIKGKCLRCVI 612
            LL CGV TG+GA W TA VE GS V IFGLG++GLAVAEGA+  GA+RIIG+D+ S K++  K FGVTEF+N K+  +K + Q+IID+TDGG DY FEC+G  S+++ A  CC KGWG ++++GV   G ++S   F+++ +G++  G+ FGG K++S +P L+++Y+ KE+++D+++TH +   EIN AFDLL +G+CLRCV+
Sbjct:  173 LLGCGVPTGLGAVWNTAKVEPGSIVAIFGLGTVGLAVAEGAKSAGASRIIGIDIDSNKYDTAKNFGVTEFINPKD-HEKPIQQVIIDLTDGGVDYSFECLGNVSVMRSALECCHKGWGTSVIVGVAASGQEISTRPFQLV-TGRVWKGTAFGGFKSRSQVPWLVEKYLKKEIKVDEYITHNLTLLEINKAFDLLHEGQCLRCVL 374          
BLAST of CX299917 vs. ExPASy Swiss-Prot
Match: ADHX_MAIZE (Alcohol dehydrogenase class-3 OS=Zea mays GN=FDH PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.021e-59
Identity = 102/206 (49.51%), Postives = 152/206 (73.79%), Query Frame = 1
Query:    1 LLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWGKTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFVTHEMKFEEINSAFDLLIKGKCLRCVIWM 618
            LL CGV TG+GA W TA VE GS V +FGLG++GLAVAEGA+  GA+R+IG+D+ ++KF++ K FGVTEFVN K   DK + Q+++D+TDGG DY FEC+G  S+++ A  C  KGWG ++++GV   G ++S   F+++ +G++  G+ FGG K+++ +P L+ +YM KE+++D+++TH M   +IN AF LL +G CLRCV+ M
Sbjct:  176 LLGCGVPTGLGAVWNTAKVESGSVVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDNKKFDVAKNFGVTEFVNPKE-HDKPIQQVLVDLTDGGVDYSFECIGNVSIMRAALECSDKGWGTSVIVGVAASGQEISTRPFQLV-TGRVWKGTAFGGFKSRTQVPWLVDKYMKKEIKVDEYITHNMNLADINDAFHLLHEGGCLRCVLAM 379          
BLAST of CX299917 vs. ExPASy Swiss-Prot
Match: ADHL6_ARATH (Alcohol dehydrogenase-like 6 OS=Arabidopsis thaliana GN=At5g24760 PE=2 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 1.168e-55
Identity = 106/206 (51.46%), Postives = 148/206 (71.84%), Query Frame = 1
Query:    1 LLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWGKTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFVTHEMKFEEINSAFDLLIKGKCLRCVIWM 618
            LLSCGV+ G+GAAW  A+V+ GS+VVIFGLG++GL+VA+GA+L GA +I+GVD+   K E  K FGVT+F+NS +  +  + Q+I  MT GGAD+ FECVG   +   A   C  GWG T+ LGV +   ++S + + +  SGK L G+LFGG K KSD+P L+ +YM+KE+ +D+F+TH + F+EIN AF L+ +GKCLRCV+ M
Sbjct:  176 LLSCGVAAGLGAAWNVADVQKGSSVVIFGLGTVGLSVAQGAKLRGAAQILGVDINPAKAEQAKTFGVTDFINSNDLSE-PIPQVIKRMTGGGADFSFECVGDTGIATTALQSCSDGWGMTVTLGVPKAKPEVS-AHYGLFLSGKSLKGTLFGGWKPKSDLPSLIDKYMNKEIMIDEFITHNLSFDEINKAFVLMREGKCLRCVLHM 379          
The following BLAST results are available for this feature:
BLAST of CX299917 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 119
Match NameE-valueIdentityDescription
ADHL7_ARATH3.713e-9479.23Alcohol dehydrogenase-like 7 OS=Arabidopsis thalia... [more]
ADHL5_ARATH8.050e-7362.50Alcohol dehydrogenase-like 5 OS=Arabidopsis thalia... [more]
ADHL1_ARATH3.059e-7261.17Alcohol dehydrogenase-like 1 OS=Arabidopsis thalia... [more]
ADHL2_ARATH1.088e-6961.65Alcohol dehydrogenase-like 2 OS=Arabidopsis thalia... [more]
ADHX_ORYSJ8.921e-6453.43Alcohol dehydrogenase class-3 OS=Oryza sativa subs... [more]
ADHX_ORYSI8.921e-6453.43Alcohol dehydrogenase class-3 OS=Oryza sativa subs... [more]
ADHX_ARATH1.090e-6151.47Alcohol dehydrogenase class-3 OS=Arabidopsis thali... [more]
ADHX_PEA5.412e-6151.47Alcohol dehydrogenase class-3 OS=Pisum sativum PE=... [more]
ADHX_MAIZE1.021e-5949.51Alcohol dehydrogenase class-3 OS=Zea mays GN=FDH P... [more]
ADHL6_ARATH1.168e-5551.46Alcohol dehydrogenase-like 6 OS=Arabidopsis thalia... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004A03SK SaltLeaf1 Citrus clementina cDNA clone C07004A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299917 ID=CX299917|Name=CX299917|organism=Citrus clementina|type=EST|length=719bp
CTTCTAAGCTGTGGAGTATCAACAGGCGTGGGAGCTGCTTGGAGAACAGC
AAATGTAGAGGTTGGATCAACTGTTGTTATATTTGGGCTTGGTTCAATTG
GATTAGCGGTTGCAGAGGGAGCGAGATTATGTGGTGCTACAAGGATTATA
GGCGTGGATGTGATCTCGGAAAAATTTGAAATTGGAAAAAGGTTTGGAGT
TACAGAGTTTGTGAATTCTAAAAACTGTGGGGATAAATCTGTAAGCCAGA
TAATCATTGACATGACTGATGGGGGTGCTGATTACTGCTTTGAATGTGTT
GGTTTGGCATCCTTGGTGCAAGAAGCATATGCTTGTTGCCGAAAGGGTTG
GGGGAAAACAATTGTGTTGGGAGTGGACCAGCCGGGGTCACAGTTGAGCC
TGAGCTCTTTTGAGGTCCTTCACAGTGGAAAAATTCTGATGGGATCATTG
TTTGGAGGTCTCAAAGCTAAATCTGATATTCCTATTCTTTTGAAACGTTA
CATGGATAAGGAACTAGAGCTGGATAAGTTTGTCACTCATGAGATGAAGT
TTGAAGAAATCAATAGCGCGTTTGATTTACTTATAAAAGGAAAGTGTCTC
CGTTGTGTGATATGGATGGGCGAATAAGATTTCTTGCATTATTTTCTTGT
ATGTACTTTCTCCAATATTACCTCTCATATCTAAGCAATTGACCACCATT
TGTGATGGACATGTGTATA
back to top