CX299919

Overview
NameCX299919
Unique NameCX299919
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length613
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX299919 vs. ExPASy Swiss-Prot
Match: PROF_PRUPE (Profilin OS=Prunus persica PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.026e-53
Identity = 95/107 (88.79%), Postives = 104/107 (97.20%), Query Frame = 1
Query:    1 IIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 321
            IIGHDGSVWAQS  FPQLKPEE+TGI+NDFNEPG+LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVT+KK++ AL+IGIYDEPMTPGQCNMIVERLGDYL++QGL
Sbjct:   25 IIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVERLGDYLVEQGL 131          
BLAST of CX299919 vs. ExPASy Swiss-Prot
Match: PROF2_MALDO (Profilin-2 OS=Malus domestica PE=1 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.998e-52
Identity = 94/107 (87.85%), Postives = 103/107 (96.26%), Query Frame = 1
Query:    1 IIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 321
            IIGH+GSVWAQS  FPQLKPEE+TGIMNDFNEPG+LAPTGLYLGGTKYMVIQGEPG VIRGKKGPGGVT+KK++ AL+IGIYDEPMTPGQCNM+VERLGDYLI+QGL
Sbjct:   25 IIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVERLGDYLIEQGL 131          
BLAST of CX299919 vs. ExPASy Swiss-Prot
Match: PROF2_SOYBN (Profilin-2 OS=Glycine max GN=PRO2 PE=1 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 3.408e-52
Identity = 96/106 (90.57%), Postives = 100/106 (94.34%), Query Frame = 1
Query:    1 IIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 318
            IIG DGSVW QS +FPQ KPEEIT IMNDFNEPG+LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVT+KKT AALIIGIYDEPMTPGQCNM+VERLGDYLIDQG
Sbjct:   25 IIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERLGDYLIDQG 130          
BLAST of CX299919 vs. ExPASy Swiss-Prot
Match: PROF2_AMBAR (Profilin-2 OS=Ambrosia artemisiifolia GN=A0418 PE=1 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 3.408e-52
Identity = 96/106 (90.57%), Postives = 101/106 (95.28%), Query Frame = 1
Query:    1 IIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 318
            IIGHDG VWAQS  FPQ+KPEEITGIMNDFNEPG+LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKT+ ALIIGIYDEPM PGQCNMIVERLGDYL++QG
Sbjct:   25 IIGHDGVVWAQSATFPQVKPEEITGIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTTMALIIGIYDEPMAPGQCNMIVERLGDYLLEQG 130          
BLAST of CX299919 vs. ExPASy Swiss-Prot
Match: PROF1_RICCO (Profilin-1 OS=Ricinus communis GN=PRO1 PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 3.408e-52
Identity = 97/107 (90.65%), Postives = 100/107 (93.46%), Query Frame = 1
Query:    1 IIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 321
            IIG DGSVWAQS  FPQ KPEEIT IMNDFNEPG+LAPTGLYL GTKYMVIQGEPGAVIRGKKGPGGVT+KKT+ ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
Sbjct:   25 IIGQDGSVWAQSSTFPQFKPEEITAIMNDFNEPGSLAPTGLYLSGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 131          
BLAST of CX299919 vs. ExPASy Swiss-Prot
Match: PROF1_PHAVU (Profilin-1 OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 3.408e-52
Identity = 94/107 (87.85%), Postives = 103/107 (96.26%), Query Frame = 1
Query:    1 IIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 321
            I+G DGSVWA+S +FPQ KPEEITGIMNDFNEPGTLAPTGLY+GGTKYMVIQGEPG+VIRGKKGPGGVT+KKT+ AL+IGIYDEPMTPGQCNMIVERLGDYLI+QGL
Sbjct:   25 ILGQDGSVWAKSASFPQFKPEEITGIMNDFNEPGTLAPTGLYIGGTKYMVIQGEPGSVIRGKKGPGGVTVKKTNLALVIGIYDEPMTPGQCNMIVERLGDYLIEQGL 131          
BLAST of CX299919 vs. ExPASy Swiss-Prot
Match: PROF1_SOYBN (Profilin-1 OS=Glycine max GN=PRO1 PE=1 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 5.814e-52
Identity = 96/106 (90.57%), Postives = 100/106 (94.34%), Query Frame = 1
Query:    1 IIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 318
            IIG DGSVWAQS +FPQ KPEEIT IMNDFNEPG+LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVT+KKT AALIIGIYDEPMTPGQCNM+VER GDYLIDQG
Sbjct:   25 IIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERPGDYLIDQG 130          
BLAST of CX299919 vs. ExPASy Swiss-Prot
Match: PROF2_HEVBR (Profilin-2 OS=Hevea brasiliensis GN=PRO2 PE=1 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 7.593e-52
Identity = 96/106 (90.57%), Postives = 101/106 (95.28%), Query Frame = 1
Query:    1 IIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 318
            IIG DGSVWAQS NFPQ K EEITGIM+DF+EPGTLAPTGLY+GGTKYMVIQGEPGAVIRGKKGPGGVT+KKT+ ALIIGIYDEPMTPGQCNMIVERLGDYLIDQG
Sbjct:   25 IIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 130          
BLAST of CX299919 vs. ExPASy Swiss-Prot
Match: PROF_FRAAN (Profilin OS=Fragaria ananassa PE=1 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 9.917e-52
Identity = 94/107 (87.85%), Postives = 102/107 (95.33%), Query Frame = 1
Query:    1 IIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 321
            IIG DGSVWAQS  FPQLKPEE+TGI+ DF+EPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVT+KKT+ AL+IGIYDEPMTPGQCNMIVERLGDYL++QGL
Sbjct:   25 IIGQDGSVWAQSATFPQLKPEEVTGIVRDFDEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTTLALLIGIYDEPMTPGQCNMIVERLGDYLVEQGL 131          
BLAST of CX299919 vs. ExPASy Swiss-Prot
Match: PROF_CUCME (Profilin OS=Cucumis melo PE=1 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.209e-51
Identity = 93/107 (86.92%), Postives = 100/107 (93.46%), Query Frame = 1
Query:    1 IIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 321
            IIG DGSVWAQS+NFPQLKPEE+ GI+ DF +PGTLAPTGLY+GGTKYMVIQGEPGAVIRGKKGPGG T+KKT  AL+IGIYDEPMTPGQCNMIVERLGDYLIDQGL
Sbjct:   25 IIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGATVKKTGMALVIGIYDEPMTPGQCNMIVERLGDYLIDQGL 131          
The following BLAST results are available for this feature:
BLAST of CX299919 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
PROF_PRUPE4.026e-5388.79Profilin OS=Prunus persica PE=1 SV=1[more]
PROF2_MALDO1.998e-5287.85Profilin-2 OS=Malus domestica PE=1 SV=1[more]
PROF2_SOYBN3.408e-5290.57Profilin-2 OS=Glycine max GN=PRO2 PE=1 SV=1[more]
PROF2_AMBAR3.408e-5290.57Profilin-2 OS=Ambrosia artemisiifolia GN=A0418 PE=... [more]
PROF1_RICCO3.408e-5290.65Profilin-1 OS=Ricinus communis GN=PRO1 PE=2 SV=1[more]
PROF1_PHAVU3.408e-5287.85Profilin-1 OS=Phaseolus vulgaris PE=1 SV=1[more]
PROF1_SOYBN5.814e-5290.57Profilin-1 OS=Glycine max GN=PRO1 PE=1 SV=1[more]
PROF2_HEVBR7.593e-5290.57Profilin-2 OS=Hevea brasiliensis GN=PRO2 PE=1 SV=1[more]
PROF_FRAAN9.917e-5287.85Profilin OS=Fragaria ananassa PE=1 SV=1[more]
PROF_CUCME2.209e-5186.92Profilin OS=Cucumis melo PE=1 SV=1[more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004A06SK SaltLeaf1 Citrus clementina cDNA clone C07004A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299919 ID=CX299919|Name=CX299919|organism=Citrus clementina|type=EST|length=613bp
ATCATCGGCCACGACGGCAGCGTTTGGGCCCAGAGTGAAAACTTCCCTCA
GTTAAAACCTGAGGAAATAACTGGTATCATGAATGACTTTAATGAACCTG
GAACACTAGCACCAACTGGACTGTATCTTGGTGGCACAAAATATATGGTG
ATCCAGGGTGAGCCAGGTGCTGTCATCCGAGGGAAGAAGGGCCCTGGTGG
TGTTACCATCAAGAAGACCAGTGCGGCCTTAATCATTGGAATCTATGATG
AGCCGATGACCCCTGGGCAGTGCAACATGATTGTTGAAAGGCTTGGTGAT
TATCTCATTGATCAGGGTCTTTAGGTGGTTTGCATGTCCGCTAATTTGTT
TCATTTCTTGGCTTCCCTAAAAAGCTCGCACTGTTGAACTTCGGTGTAAT
AATATTACAGTATTCAAAGTTATGGGAACTGTGTGTGGAAAGGAAAGGTT
TGGTGCATGTGGAAGTTCTTGATATCATCTATTTGTAGTATTGTTATGGT
TGTCAAGGTACTTTACCAATCACTATTACAGTGGATCCTAATGGATGTGT
CAATTTGAGTTGTAAAACTTGTGAGATTCTTGTTTCTCAATGTATTTTGC
GTTGGTTGTTGAA
back to top