CX299921

Overview
NameCX299921
Unique NameCX299921
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length401
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX299921 vs. ExPASy Swiss-Prot
Match: RL8_SOLLC (60S ribosomal protein L8 OS=Solanum lycopersicum GN=RPL8 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.746e-28
Identity = 54/55 (98.18%), Postives = 55/55 (100.00%), Query Frame = 1
Query:    1 NAYHKFRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI 165
            NAYHK+RVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI
Sbjct:  184 NAYHKYRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI 238          
BLAST of CX299921 vs. ExPASy Swiss-Prot
Match: RL83_ARATH (60S ribosomal protein L8-3 OS=Arabidopsis thaliana GN=RPL8C PE=2 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 5.081e-28
Identity = 53/55 (96.36%), Postives = 55/55 (100.00%), Query Frame = 1
Query:    1 NAYHKFRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI 165
            NAYHK+RVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPG+KVGLI
Sbjct:  184 NAYHKYRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGKKVGLI 238          
BLAST of CX299921 vs. ExPASy Swiss-Prot
Match: RL8_TOBAC (60S ribosomal protein L8 OS=Nicotiana tabacum GN=RPL8 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 8.667e-28
Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 1
Query:    1 NAYHKFRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI 165
            NAYHK+RVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTV RDAPPGQKVGLI
Sbjct:  184 NAYHKYRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVARDAPPGQKVGLI 238          
BLAST of CX299921 vs. ExPASy Swiss-Prot
Match: RL81_ARATH (60S ribosomal protein L8-1 OS=Arabidopsis thaliana GN=RPL8A PE=2 SV=2)

HSP 1 Score: 120.553 bits (301), Expect = 2.522e-27
Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 1
Query:    1 NAYHKFRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI 165
            NAYHK+RVKRN WPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI
Sbjct:  184 NAYHKYRVKRNSWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI 238          
BLAST of CX299921 vs. ExPASy Swiss-Prot
Match: RL8_ANOGA (60S ribosomal protein L8 OS=Anopheles gambiae GN=RpL8 PE=2 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 2.609e-24
Identity = 47/54 (87.04%), Postives = 51/54 (94.44%), Query Frame = 1
Query:    4 AYHKFRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI 165
            AYHK++VKRNCWPKVRGVAMNPVEHPHGGGNHQHIG ASTV+R  PPG+KVGLI
Sbjct:  185 AYHKYKVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGKASTVKRGTPPGRKVGLI 238          
BLAST of CX299921 vs. ExPASy Swiss-Prot
Match: RL8_AEDAL (60S ribosomal protein L8 OS=Aedes albopictus GN=RpL8 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.209e-23
Identity = 46/54 (85.19%), Postives = 50/54 (92.59%), Query Frame = 1
Query:    4 AYHKFRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI 165
            AY K++VKRNCWPKVRGVAMNPVEHPHGGGNHQHIG ASTV+R  PPG+KVGLI
Sbjct:  185 AYRKYKVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGKASTVKRGTPPGRKVGLI 238          
BLAST of CX299921 vs. ExPASy Swiss-Prot
Match: RL82_ARATH (60S ribosomal protein L8-2 OS=Arabidopsis thaliana GN=RPL8B PE=2 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 4.921e-23
Identity = 46/55 (83.64%), Postives = 48/55 (87.27%), Query Frame = 1
Query:    1 NAYHKFRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI 165
            NAYHK++ KRNCWP VRGVAMNPVEHPHGGGNHQHIGHASTVRRD   G KVG I
Sbjct:  185 NAYHKYKAKRNCWPVVRGVAMNPVEHPHGGGNHQHIGHASTVRRDKSAGAKVGQI 239          
BLAST of CX299921 vs. ExPASy Swiss-Prot
Match: RL2_SCHPO (60S ribosomal protein L2 OS=Schizosaccharomyces pombe GN=rpl2a PE=2 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 1.432e-22
Identity = 42/54 (77.78%), Postives = 50/54 (92.59%), Query Frame = 1
Query:    4 AYHKFRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI 165
            A+HK+RVKRNCWP+ RGVAMNPV+HPHGGGNHQH+GH++TV R + PGQKVGLI
Sbjct:  184 AFHKYRVKRNCWPRTRGVAMNPVDHPHGGGNHQHVGHSTTVPRQSAPGQKVGLI 237          
BLAST of CX299921 vs. ExPASy Swiss-Prot
Match: RL8_XENTR (60S ribosomal protein L8 OS=Xenopus tropicalis GN=rpl8 PE=2 SV=3)

HSP 1 Score: 104.375 bits (259), Expect = 1.870e-22
Identity = 44/54 (81.48%), Postives = 49/54 (90.74%), Query Frame = 1
Query:    4 AYHKFRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI 165
            AYHK++ KRNCWP+VRGVAMNPVEHP GGGNHQHIG  ST+RRDAP G+KVGLI
Sbjct:  185 AYHKYKAKRNCWPRVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLI 238          
BLAST of CX299921 vs. ExPASy Swiss-Prot
Match: RL8_XENLA (60S ribosomal protein L8 OS=Xenopus laevis GN=rpl8 PE=2 SV=3)

HSP 1 Score: 104.375 bits (259), Expect = 1.870e-22
Identity = 44/54 (81.48%), Postives = 49/54 (90.74%), Query Frame = 1
Query:    4 AYHKFRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLI 165
            AYHK++ KRNCWP+VRGVAMNPVEHP GGGNHQHIG  ST+RRDAP G+KVGLI
Sbjct:  185 AYHKYKAKRNCWPRVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLI 238          
The following BLAST results are available for this feature:
BLAST of CX299921 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 79
Match NameE-valueIdentityDescription
RL8_SOLLC1.746e-2898.1860S ribosomal protein L8 OS=Solanum lycopersicum G... [more]
RL83_ARATH5.081e-2896.3660S ribosomal protein L8-3 OS=Arabidopsis thaliana... [more]
RL8_TOBAC8.667e-2896.3660S ribosomal protein L8 OS=Nicotiana tabacum GN=R... [more]
RL81_ARATH2.522e-2796.3660S ribosomal protein L8-1 OS=Arabidopsis thaliana... [more]
RL8_ANOGA2.609e-2487.0460S ribosomal protein L8 OS=Anopheles gambiae GN=R... [more]
RL8_AEDAL2.209e-2385.1960S ribosomal protein L8 OS=Aedes albopictus GN=Rp... [more]
RL82_ARATH4.921e-2383.6460S ribosomal protein L8-2 OS=Arabidopsis thaliana... [more]
RL2_SCHPO1.432e-2277.7860S ribosomal protein L2 OS=Schizosaccharomyces po... [more]
RL8_XENTR1.870e-2281.4860S ribosomal protein L8 OS=Xenopus tropicalis GN=... [more]
RL8_XENLA1.870e-2281.4860S ribosomal protein L8 OS=Xenopus laevis GN=rpl8... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004A08SK SaltLeaf1 Citrus clementina cDNA clone C07004A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299921 ID=CX299921|Name=CX299921|organism=Citrus clementina|type=EST|length=401bp
AATGCTTATCACAAGTTCAGGGTGAAGAGGAACTGCTGGCCCAAGGTCCG
TGGTGTTGCCATGAACCCTGTTGAGCATCCCCATGGTGGTGGTAACCACC
AGCACATTGGGCATGCAAGTACGGTTCGCCGTGATGCACCCCCTGGCCAA
AAGGTTGGTCTTATTGCTGCTAGGAGGACTGGTCGTCTTAGAGGACAAGC
AGCTGCCACTGCTGCAAAGGCTGACAAGGCTTAGAGTTTCGCTTGAGCTC
ATTTTAATTTTGTTTTGTGCTGTTGAACATCTTCATATGGTTGTTATCTG
TTAGCATTAGATTTTGGTTTGCAATTTTGGAAGGTTACTAACTTCTTGTG
ATTAGTACATTGAAAGTGAGAGTATTTTGTTTTAAAAAAAAAAAAAAAAA
A
back to top