CX299931

Overview
NameCX299931
Unique NameCX299931
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length499
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14812 contig Ccv1_Contig14812:159..657. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX299931 vs. ExPASy Swiss-Prot
Match: DCE_SOLLC (Glutamate decarboxylase OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 8.379e-20
Identity = 47/102 (46.08%), Postives = 68/102 (66.67%), Query Frame = 2
Query:    2 WIVPAYTMPANAENVAVLRVVVREDFSRSLVERLISHIEEVLKEIESLPSRVSTKTAHV-IPMVNETQGD--KPLKKSVRETQEEVTRHWKRFVKGRRAGAC 298
            WIVPAYTMP +AE++AVLRVV+REDFS SL ERL+S IE++L E+++ P R+ TK   V    V + +GD          ETQ+++ +HW++    + +G C
Sbjct:  401 WIVPAYTMPPDAEHIAVLRVVIREDFSHSLAERLVSDIEKILSELDTQPPRLPTKAVRVTAEEVRDDKGDGLHHFHMDTVETQKDIIKHWRKIAGKKTSGVC 502          
BLAST of CX299931 vs. ExPASy Swiss-Prot
Match: DCE_PETHY (Glutamate decarboxylase OS=Petunia hybrida GN=GAD PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.184e-19
Identity = 48/95 (50.53%), Postives = 67/95 (70.53%), Query Frame = 2
Query:    2 WIVPAYTMPANAENVAVLRVVVREDFSRSLVERLISHIEEVLKEIESLPSRVSTKTAHVIPMVNETQGDKPLKKSVRETQEEVTRHWKRFVKGRR 286
            WIVPAYTMP NA+++ VLRVV+REDFSR+L ERL+  IE+VL E+++LP+RV+ K A V        G +  KK+  E Q E+   WK+FV+ ++
Sbjct:  400 WIVPAYTMPPNAQHITVLRVVIREDFSRTLAERLVRDIEKVLHELDTLPARVNAKLA-VAEEQAAANGSEVHKKTDSEVQLEMITAWKKFVEEKK 493          
BLAST of CX299931 vs. ExPASy Swiss-Prot
Match: DCE1_ARATH (Glutamate decarboxylase 1 OS=Arabidopsis thaliana GN=GAD1 PE=1 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 3.520e-18
Identity = 49/104 (47.12%), Postives = 71/104 (68.27%), Query Frame = 2
Query:    2 WIVPAYTMPANAENVAVLRVVVREDFSRSLVERLISHIEEVLKEIESLPSRVSTKTAHVIPMVNETQGDK---PLKKSVRETQEEVTRHWKRFVKGRR--AGAC 298
            WIVPAYTMP NA+++ VLRVV+REDFSR+L ERL+  IE+V++E++ LPSRV  K + +    +E+  D     +KKS  + Q ++   WK+FV  R+  +G C
Sbjct:  400 WIVPAYTMPPNAQHITVLRVVIREDFSRTLAERLVIDIEKVMRELDELPSRVIHKIS-LGQEKSESNSDNLMVTVKKSDIDKQRDIITGWKKFVADRKKTSGIC 502          
BLAST of CX299931 vs. ExPASy Swiss-Prot
Match: DCE2_ARATH (Glutamate decarboxylase 2 OS=Arabidopsis thaliana GN=GAD2 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.597e-18
Identity = 49/101 (48.51%), Postives = 70/101 (69.31%), Query Frame = 2
Query:    2 WIVPAYTMPANAENVAVLRVVVREDFSRSLVERLISHIEEVLKEIESLPSRVSTKTAHVIPMVNETQGDKPLKKSVRETQEEVTRHWKRFVKGRRA--GAC 298
            WIVPAYTMPA+A+++ VLRVV+REDFSR+L ERL++ I +VL E+++LPS++S K    I  + E   +K ++K   E   EV   W++FVK R+   G C
Sbjct:  399 WIVPAYTMPADAQHITVLRVVIREDFSRTLAERLVADISKVLHELDTLPSKISKKMG--IEGIAENVKEKKMEK---EILMEVIVGWRKFVKERKKMNGVC 494          
The following BLAST results are available for this feature:
BLAST of CX299931 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
DCE_SOLLC8.379e-2046.08Glutamate decarboxylase OS=Solanum lycopersicum PE... [more]
DCE_PETHY3.184e-1950.53Glutamate decarboxylase OS=Petunia hybrida GN=GAD ... [more]
DCE1_ARATH3.520e-1847.12Glutamate decarboxylase 1 OS=Arabidopsis thaliana ... [more]
DCE2_ARATH4.597e-1848.51Glutamate decarboxylase 2 OS=Arabidopsis thaliana ... [more]
back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004B06SK SaltLeaf1 Citrus clementina cDNA clone C07004B06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299931 ID=CX299931|Name=CX299931|organism=Citrus clementina|type=EST|length=499bp
GTGGATAGTTCCGGCCTATACAATGCCTGCTAATGCTGAAAATGTGGCGG
TTCTTCGGGTGGTTGTCAGGGAGGATTTCAGCCGTAGCTTGGTGGAAAGA
CTCATCTCACACATCGAGGAAGTTTTGAAGGAAATTGAATCGCTTCCAAG
TCGTGTATCCACGAAAACTGCCCATGTCATACCCATGGTCAACGAAACTC
AGGGTGATAAGCCACTTAAGAAGAGTGTGAGGGAGACTCAGGAGGAAGTC
ACCAGGCACTGGAAGAGGTTCGTGAAAGGCCGGAGAGCTGGAGCATGCTG
AGGTTCCAAACATAAGACGAGACAAGATTTGTATGCTTGTTTGAATATTA
AAGCTATTGCTTCTTCCTGTTTTCTGTATATTCGTACTTGAAGGTGTGTT
TACTTTATGTGATTGTTGAAGCCTATTGATGTTTTCTTGCACGCTTATGA
AGTGGCAAATAGAGGTATATGCTTATTGCTAAAAAAAAAAAAAAAAAAA
back to top