CX299938

Overview
NameCX299938
Unique NameCX299938
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length575
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX299938_ssr448 microsatellite CX299938_ssr448:448..462. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig4991 contig Ccv1_Contig4991:537..1087. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX299938 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 3.275e-67
Identity = 122/134 (91.04%), Postives = 128/134 (95.52%), Query Frame = 1
Query:    1 TVEWLTGITWQDAGKVELVEGSSYLGQPLPFSITTLIWIEVLVIGYIEFQRNSELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAVVTGKGPLNNWATHLSDPLHTTILDTFIS 402
            +VEWLTG+TWQDAGKVELV+GSSYLGQPLPFSI+TLIWIEVLVIGYIEFQRN+ELD EKRLYPGGKFFDPLGLAADPEK A LQLAEIKHARLAMVAFLGFAVQA  TGKGPLNNWATHLSDPLHTTI+DTF S
Sbjct:  156 SVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFSS 289          
BLAST of CX299938 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 9.529e-67
Identity = 121/134 (90.30%), Postives = 127/134 (94.78%), Query Frame = 1
Query:    1 TVEWLTGITWQDAGKVELVEGSSYLGQPLPFSITTLIWIEVLVIGYIEFQRNSELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAVVTGKGPLNNWATHLSDPLHTTILDTFIS 402
            TVEWLTG+TWQDAGKVELV+GSSYLGQPLPFSI+TLIWIEVLVIGYIEFQRN+ELD EKRLYPGGKFFDPLGLA+DP KKA LQLAEIKHARLAMV FLGFAVQA  TGKGPLNNWATHLSDPLHTTI+DTF S
Sbjct:  153 TVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFSS 286          
BLAST of CX299938 vs. ExPASy Swiss-Prot
Match: CB4C_ARATH (Chlorophyll a-b binding protein CP29.3, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.3 PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 2.358e-49
Identity = 98/117 (83.76%), Postives = 107/117 (91.45%), Query Frame = 1
Query:    4 VEWLTGITWQDAGKVELVEGSSYLGQPLPFSITTLIWIEVLVIGYIEFQRNSELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAVVTGKGPLNNWAT 354
            VE LTGI WQDAGKVELVEGSSYLGQPLPFS+TTLIWIEVLV+GYIEFQRNSELDPEKR+YPGG +FDPLGLAADPEK  TL+LAEIKH+RLAMVAFL FA+QA  TGKGP++  AT
Sbjct:  158 VEALTGIAWQDAGKVELVEGSSYLGQPLPFSLTTLIWIEVLVVGYIEFQRNSELDPEKRIYPGG-YFDPLGLAADPEKLDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGPVSFLAT 273          
BLAST of CX299938 vs. ExPASy Swiss-Prot
Match: CB29_CHLRE (Chlorophyll a-b binding protein CP29 OS=Chlamydomonas reinhardtii GN=Lhcb4 PE=1 SV=3)

HSP 1 Score: 134.035 bits (336), Expect = 4.940e-31
Identity = 71/116 (61.21%), Postives = 90/116 (77.59%), Query Frame = 1
Query:    7 EWLTGITWQDAGKVELVEGSSYLGQPLPFSITTLIWIEVLVIGYIEFQRNSELDPEKRLYPGGKFFDPLGLAADPEKKA-TLQLAEIKHARLAMVAFLGFAVQAVVTGKGPLNNWA 351
            E  TG++W +AGKVEL +G+SY G  LPFSIT LIWIEV+++G  EF RNSE +PEKR YPGG  FDPL LA++ E++A  L+ AEIKHARLAMV+F G+ VQA+ TG+G L + A
Sbjct:  155 EATTGVSWVEAGKVEL-DGASYAGLSLPFSITQLIWIEVILVGGAEFYRNSETNPEKRCYPGG-VFDPLKLASEDEERAFRLKTAEIKHARLAMVSFFGYGVQALSTGEGALGSLA 268          
BLAST of CX299938 vs. ExPASy Swiss-Prot
Match: CB121_HORVU (Chlorophyll a-b binding protein 1B-21, chloroplastic OS=Hordeum vulgare GN=LHC Ib-21 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 4.478e-24
Identity = 60/114 (52.63%), Postives = 77/114 (67.54%), Query Frame = 1
Query:   64 SSYLGQPLPF-SITTLIWIEVLVIGYIEFQRNSELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAV-QAVVTGKGPLNNWATHLSDPLHTTILDTFI 399
            ++YLG P+P+ ++ T++ IE L I + E QR  E DPEK+ YPGG F DPLG + DP K   L+L EIK+ RLAM+AF+GF V Q+   G GPL N ATHL+DP H  I D  I
Sbjct:  126 ATYLGNPVPWGNLPTILAIEFLAIAFAEQQRTMEKDPEKKKYPGGAF-DPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIVI 238          
BLAST of CX299938 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.222e-23
Identity = 60/128 (46.88%), Postives = 83/128 (64.84%), Query Frame = 1
Query:   28 WQDAGKVELVEG--SSYLGQPLPF-SITTLIWIEVLVIGYIEFQRNSELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAV-QAVVTGKGPLNNWATHLSDPLHTTILDTFI 399
            W  A +   + G  ++YLGQP+P+ ++ T++ IE L I ++E QR+ E D EK+ YPGG F DPLG + DP K   L++ EIK+ RLA++A +GF V Q+   G GPL N ATHL+DP H  I D  I
Sbjct:  113 WVKAQEWAAIPGGQATYLGQPVPWGTLPTILAIEFLAIAFVEHQRSMEKDSEKKKYPGGAF-DPLGYSKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATHLADPWHNNIGDVII 239          
BLAST of CX299938 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.593e-21
Identity = 57/123 (46.34%), Postives = 82/123 (66.67%), Query Frame = 1
Query:   28 WQDAGKVELVEGSS--YLGQPLPFSITTLIWIEVLVIGYIEFQR-NSELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAVVTGKGPLNNWATHLSDPLHTTIL 387
            W   G + L++G++  Y G+ +P ++   +  EV+++G  E+ R  + LD E +L+PGG F DPLGLA DPE+ A L++ EIK+ RLAM A LGF +QA VTG+GP+ N A HLSDP    +L
Sbjct:  147 WFKTGAL-LLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPF-DPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLL 267          
BLAST of CX299938 vs. ExPASy Swiss-Prot
Match: CB23_HORVU (Chlorophyll a-b binding protein of LHCII type III, chloroplastic OS=Hordeum vulgare GN=LHBC PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.141e-19
Identity = 58/122 (47.54%), Postives = 73/122 (59.84%), Query Frame = 1
Query:   28 WQDAGKVELVEGS-SYLGQPLPF---SITTLIWIEVLVIGYIEFQRNSELD---PEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAVVTGKGPLNNWATHLSDPL 372
            W  AG     EG   YLG P      SI  ++  +VL++G +E  R + LD       LYPGG++FDPLGLA DP   A L++ EIK+ RLAM +  GF VQA+VTGKGPL N   HL DP+
Sbjct:  132 WFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQVLLMGLVEGFRINGLDGVGEGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLFDHLDDPV 253          
BLAST of CX299938 vs. ExPASy Swiss-Prot
Match: CB21_SINAL (Chlorophyll a-b binding protein 1, chloroplastic OS=Sinapis alba GN=CAB1 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.337e-19
Identity = 58/124 (46.77%), Postives = 75/124 (60.48%), Query Frame = 1
Query:   28 WQDAGKVELVEGS-SYLGQPLPFSITTLIWI---EVLVIGYIEFQRNSELDP----EKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAVVTGKGPLNNWATHLSDPLH 375
            W  AG     EG   YLG P      +++ I   +V+++G +E  R +   P    E  LYPGG F DPLGLA DPE  A L++ EIK+ RLAM +  GF VQA+VTGKGPL N A HL+DP++
Sbjct:  130 WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGEGPLGEAEDLLYPGGSF-DPLGLATDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN 252          
BLAST of CX299938 vs. ExPASy Swiss-Prot
Match: CB23_APIGR (Chlorophyll a-b binding protein, chloroplastic OS=Apium graveolens GN=LHC0 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 9.663e-19
Identity = 57/126 (45.24%), Postives = 76/126 (60.32%), Query Frame = 1
Query:   28 WQDAGKVELVEGS-SYLGQPLPFSITTLIWI---EVLVIGYIEFQR------NSELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAVVTGKGPLNNWATHLSDPLH 375
            W  AG     EG   YLG P      +++ I   +V+++G +E  R         +DP   LYPGG F DPLGLA DPE+ A L++ E+K+ RLAM +  GF VQA+VTGKGPL N A HL+DP++
Sbjct:  129 WFKAGSQIFSEGGLDYLGNPSLVHAQSILSIWATQVILMGAVEGYRVAGGPLGEIVDP---LYPGGSF-DPLGLAEDPERSAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN 250          
The following BLAST results are available for this feature:
BLAST of CX299938 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
CB4A_ARATH3.275e-6791.04Chlorophyll a-b binding protein CP29.1, chloroplas... [more]
CB4B_ARATH9.529e-6790.30Chlorophyll a-b binding protein CP29.2, chloroplas... [more]
CB4C_ARATH2.358e-4983.76Chlorophyll a-b binding protein CP29.3, chloroplas... [more]
CB29_CHLRE4.940e-3161.21Chlorophyll a-b binding protein CP29 OS=Chlamydomo... [more]
CB121_HORVU4.478e-2452.63Chlorophyll a-b binding protein 1B-21, chloroplast... [more]
CB11_SOLLC2.222e-2346.88Chlorophyll a-b binding protein 6A, chloroplastic ... [more]
CB26_ARATH1.593e-2146.34Chlorophyll a-b binding protein CP26, chloroplasti... [more]
CB23_HORVU1.141e-1947.54Chlorophyll a-b binding protein of LHCII type III,... [more]
CB21_SINAL4.337e-1946.77Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB23_APIGR9.663e-1945.24Chlorophyll a-b binding protein, chloroplastic OS=... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004C02SK SaltLeaf1 Citrus clementina cDNA clone C07004C02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299938 ID=CX299938|Name=CX299938|organism=Citrus clementina|type=EST|length=575bp
ACTGTTGAGTGGCTCACTGGGATTACTTGGCAAGACGCTGGCAAGGTAGA
GTTAGTTGAAGGATCATCATACCTGGGGCAACCACTTCCATTCTCAATAA
CAACGTTGATATGGATTGAGGTTTTGGTAATTGGCTACATTGAGTTCCAA
AGAAACTCAGAGCTTGACCCGGAGAAGAGACTCTACCCGGGAGGAAAGTT
TTTTGATCCTCTGGGCTTGGCCGCTGACCCGGAAAAGAAAGCCACCCTTC
AATTGGCAGAGATCAAGCACGCCCGCCTTGCCATGGTTGCATTCCTTGGC
TTCGCTGTCCAAGCTGTTGTCACCGGAAAAGGCCCTCTCAACAACTGGGC
TACCCACTTGAGCGATCCTCTTCACACAACCATTCTTGACACCTTCATCT
CTTAGATTTCTGGTGTAGCCTCCAGTACTTGGCAGTTGGCACTATTGTTA
TTATTATTATTATATGCGCCTATCTTGTAAAAAGAATTATAACATTTGAC
AGCTTAAGGGGAATGCTATGGCTTCATATTTTGAAGTCATTTCATCTTTG
CAGAAAAAAAAAAAAAAAAAAAAAA
back to top