CX299941

Overview
NameCX299941
Unique NameCX299941
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length680
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9445 contig Ccv1_Contig9445:1541..2220. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX299941 vs. ExPASy Swiss-Prot
Match: SSG1_ANTMA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Antirrhinum majus GN=WAXY PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 6.432e-53
Identity = 99/133 (74.44%), Postives = 112/133 (84.21%), Query Frame = 1
Query:    1 FYFDSSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 399
            F    SRFEPCGLIQLHAMRYGT+PI ASTGGLVDTV EGFTGF MG+F+V+C  VDP DV  ++TTV RALA YG+ A  EM++N MAQDLSWKGPAK WE+ LL+L V+GSEPG+DGEEIAPLAKENVATP
Sbjct:  476 FMLVPSRFEPCGLIQLHAMRYGTIPICASTGGLVDTVTEGFTGFHMGAFNVECATVDPADVQKIATTVERALAAYGSVAYKEMIQNCMAQDLSWKGPAKNWEKMLLSLGVSGSEPGVDGEEIAPLAKENVATP 608          
BLAST of CX299941 vs. ExPASy Swiss-Prot
Match: SSG1_SOLTU (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Solanum tuberosum GN=WAXY PE=1 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.213e-51
Identity = 97/133 (72.93%), Postives = 111/133 (83.46%), Query Frame = 1
Query:    1 FYFDSSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 399
            F    SRFEPCGLIQLHAMRYGTVPI ASTGGLVDTV+EG+TGF MG+F+V+C+ VDP DV  + TTV RALA YGT A AEM+KN M+++LSWK PAKKWE  LL L  +GSEPG++GEEIAPLAKENVATP
Sbjct:  475 FMLVPSRFEPCGLIQLHAMRYGTVPICASTGGLVDTVKEGYTGFHMGAFNVECDVVDPADVLKIVTTVARALAVYGTLAFAEMIKNCMSEELSWKEPAKKWETLLLGLGASGSEPGVEGEEIAPLAKENVATP 607          
BLAST of CX299941 vs. ExPASy Swiss-Prot
Match: SSG1_MANES (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Manihot esculenta GN=WAXY PE=2 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.702e-51
Identity = 98/133 (73.68%), Postives = 110/133 (82.71%), Query Frame = 1
Query:    1 FYFDSSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 399
            F    SRFEPCGLIQLHAMRYGTVPIVASTGGLVDTV+EG+TGFQMG+  V+C+ +D  DVAA+  TV RAL TY T AL EM+ N MAQDLSWKGPA+ WE+ LL+LEV GSEPG +GEEIAPLAKENV TP
Sbjct:  476 FMLVPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVKEGYTGFQMGALHVECDKIDSADVAAIVKTVARALGTYATAALREMILNCMAQDLSWKGPARMWEKMLLDLEVTGSEPGTEGEEIAPLAKENVPTP 608          
BLAST of CX299941 vs. ExPASy Swiss-Prot
Match: SSG1_IPOBA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Ipomoea batatas GN=WAXY PE=2 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 3.529e-51
Identity = 99/133 (74.44%), Postives = 110/133 (82.71%), Query Frame = 1
Query:    1 FYFDSSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 399
            F    SRFEPCGLIQLHAMRYGT  I ASTGGLVDTV+EG+TGF MG+F+VDCE VDP DV  V TTV RALA YGT A  EM+KN M+Q+LSWKGPAK WE  LL+L VAGSEPG++G+EIAPLAKENVATP
Sbjct:  476 FMLIPSRFEPCGLIQLHAMRYGTPCICASTGGLVDTVKEGYTGFHMGAFNVDCETVDPEDVLKVITTVGRALAMYGTLAFTEMIKNCMSQELSWKGPAKNWETVLLSLGVAGSEPGVEGDEIAPLAKENVATP 608          
BLAST of CX299941 vs. ExPASy Swiss-Prot
Match: SSG1_ARATH (Probable granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=WAXY PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.483e-49
Identity = 95/133 (71.43%), Postives = 108/133 (81.20%), Query Frame = 1
Query:    1 FYFDSSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 399
            F    SRFEPCGLIQLHAMRYGTVPIVASTGGLVDTV++G+TGF +G F+V CE VDP DV A +  V RA+A YGT A+ EM+KN M QD SWKGPA+ WE+ LL+L VAGSE G +GEEIAPLAKENVATP
Sbjct:  478 FIIVPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVKDGYTGFHIGRFNVKCEVVDPDDVIATAKAVTRAVAVYGTSAMQEMVKNCMDQDFSWKGPARLWEKVLLSLNVAGSEAGTEGEEIAPLAKENVATP 610          
BLAST of CX299941 vs. ExPASy Swiss-Prot
Match: SSG1_PEA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 8.136e-48
Identity = 91/128 (71.09%), Postives = 107/128 (83.59%), Query Frame = 1
Query:   16 SRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 399
            SRFEPCGL+QLHAM YGTVPIV+STGGLVDTV+EG+TGF  G F V+CE VDP DV  ++ TV+RAL TYGTQA+ +++ N MAQ+ SWK PAK WE+ LLNLEV G+  GIDG+EIAPLAKENVATP
Sbjct:  476 SRFEPCGLVQLHAMPYGTVPIVSSTGGLVDTVKEGYTGFHAGPFDVECEDVDPDDVDKLAATVKRALKTYGTQAMKQIILNCMAQNFSWKKPAKLWEKALLNLEVTGNVAGIDGDEIAPLAKENVATP 603          
BLAST of CX299941 vs. ExPASy Swiss-Prot
Match: SSG1B_HORVU (Granule-bound starch synthase 1b, chloroplastic/amyloplastic (Fragment) OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.995e-47
Identity = 93/133 (69.92%), Postives = 103/133 (77.44%), Query Frame = 1
Query:    1 FYFDSSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 399
            F    SRFEPCGLIQL  M YG VPI +STGGLVDTV EG TGF MGSF+V+ E VDP DVAAV + V RAL  Y T     M++N MAQDLSWKGPAKKWEE LL+L V GS+PGI+GEEIAPLAK+NVATP
Sbjct:  433 FIIIPSRFEPCGLIQLQGMSYGVVPICSSTGGLVDTVREGVTGFHMGSFNVEFETVDPTDVAAVGSNVTRALKQYRTPVFHAMVQNCMAQDLSWKGPAKKWEEALLSLGVEGSQPGIEGEEIAPLAKQNVATP 565          
BLAST of CX299941 vs. ExPASy Swiss-Prot
Match: SSG1_SORBI (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Sorghum bicolor GN=WAXY PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 4.936e-45
Identity = 89/129 (68.99%), Postives = 99/129 (76.74%), Query Frame = 1
Query:   13 SSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 399
            +SRFEPCGLIQL  MRYGT    ASTGGLVDT+ EG TGF MG  SVDC  V+P DV  V+TT++RA+   GT A  EM+KN M QDLSWKGPAK WE  LL+L VAG EPGI+GEEIAPLAKENVA P
Sbjct:  480 TSRFEPCGLIQLQGMRYGTPCACASTGGLVDTIIEGKTGFHMGRLSVDCNVVEPADVKKVATTLKRAIKVVGTPAYEEMVKNCMIQDLSWKGPAKNWENVLLSLGVAGGEPGIEGEEIAPLAKENVAAP 608          
BLAST of CX299941 vs. ExPASy Swiss-Prot
Match: SSG1_ORYSA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Oryza sativa GN=WAXY PE=3 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.876e-44
Identity = 89/128 (69.53%), Postives = 99/128 (77.34%), Query Frame = 1
Query:   16 SRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 399
            SRFEPCGLIQL  MRYGT    ASTGGLVDTV EG TGF MG  SVDC+ V+P DV  V+TT++RA+   GT A  EM++N M QDLSWKGPAK WE  LL L VAGSEPG++GEEIAPLAKENVA P
Sbjct:  479 SRFEPCGLIQLQGMRYGTPCACASTGGLVDTVIEGKTGFHMGRLSVDCKVVEPSDVQKVATTLKRAIKIVGTPAYNEMVRNCMNQDLSWKGPAKNWENVLLGLGVAGSEPGVEGEEIAPLAKENVAAP 606          
BLAST of CX299941 vs. ExPASy Swiss-Prot
Match: SSG1_MAIZE (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Zea mays GN=WAXY PE=3 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.876e-44
Identity = 87/129 (67.44%), Postives = 99/129 (76.74%), Query Frame = 1
Query:   13 SSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 399
            +SRFEPCGLIQL  MRYGT    ASTGGLVDT+ EG TGF MG  SVDC  V+P DV  V+TT++RA+   GT A  EM++N M QDLSWKGPAK WE  LL+L VAG EPG++GEEIAPLAKENVA P
Sbjct:  477 TSRFEPCGLIQLQGMRYGTPCACASTGGLVDTIIEGKTGFHMGRLSVDCNVVEPADVKKVATTLQRAIKVVGTPAYEEMVRNCMIQDLSWKGPAKNWENVLLSLGVAGGEPGVEGEEIAPLAKENVAAP 605          
The following BLAST results are available for this feature:
BLAST of CX299941 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 65
Match NameE-valueIdentityDescription
SSG1_ANTMA6.432e-5374.44Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_SOLTU1.213e-5172.93Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_MANES2.702e-5173.68Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_IPOBA3.529e-5174.44Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_ARATH1.483e-4971.43Probable granule-bound starch synthase 1, chloropl... [more]
SSG1_PEA8.136e-4871.09Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1B_HORVU8.995e-4769.92Granule-bound starch synthase 1b, chloroplastic/am... [more]
SSG1_SORBI4.936e-4568.99Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_ORYSA1.876e-4469.53Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_MAIZE1.876e-4467.44Granule-bound starch synthase 1, chloroplastic/amy... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004C05SK SaltLeaf1 Citrus clementina cDNA clone C07004C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299941 ID=CX299941|Name=CX299941|organism=Citrus clementina|type=EST|length=680bp
TTTTATTTTGATTCCAGCAGATTTGAACCTTGTGGTCTCATTCAATTACA
TGCCATGCGTTATGGAACCGTACCTATCGTGGCTTCCACTGGTGGTTTGG
TTGACACTGTGGAAGAAGGCTTTACAGGATTCCAGATGGGAAGCTTCAGT
GTTGACTGTGAGGCTGTGGATCCAGTAGATGTGGCTGCAGTGTCCACAAC
CGTCAGAAGAGCTCTTGCAACCTATGGTACTCAAGCTTTGGCTGAAATGA
TGAAAAATGGCATGGCTCAAGATCTTTCATGGAAAGGACCAGCTAAGAAA
TGGGAGGAGACCCTACTTAACCTGGAAGTTGCTGGTAGTGAACCTGGAAT
TGACGGCGAAGAAATTGCTCCTCTTGCCAAGGAAAATGTGGCCACTCCTT
GATCGAGGCTACAAAAATCTCCACTTTTATTTTGGACCGCAAACATGTTC
CTGTAATTCTCCACAACCCAAGATATTACTTAGGAAATAACATAGGTTGG
CAGTATATGCAGCATGCGCTATTTTCAATAATGGTTTGGAGTTGAGACAT
TAGTGTTTACCTTGTATAATGAAATATTAAGTTCTGTTTTACAGTTTTGT
AAAAGGGCTCTGAGGGCTGTCGCCACTCTCCTGAAATGAAAAAGTTCAAC
TGAACAAGTTTATAAAAAAAAAAAAAAAAA
back to top