CX299942

Overview
NameCX299942
Unique NameCX299942
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length591
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9765 contig Ccv1_Contig9765:362..952. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX299942 vs. ExPASy Swiss-Prot
Match: CB4A_SOLLC (Chlorophyll a-b binding protein CP24 10A, chloroplastic OS=Solanum lycopersicum GN=CAP10A PE=3 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 4.423e-86
Identity = 146/160 (91.25%), Postives = 157/160 (98.12%), Query Frame = 1
Query:    1 AFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAGQGKTP 480
            AFLKWYREAELIHGRWAMAAV+GIFVGQAWSGIPWFEAGADPGAIAPFSFG+LLGTQL+LMGWVESKRWVDFF+P+SQSVEWATPWS+TAENFAN TGEQGYPGGKFFDPL LAGT+ +GVY+PDTEKL+RLKVAEIKHARLAM+AMLIFYFEAGQGKTP
Sbjct:   91 AFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGTLLGTQLILMGWVESKRWVDFFDPDSQSVEWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLERLKVAEIKHARLAMLAMLIFYFEAGQGKTP 250          
BLAST of CX299942 vs. ExPASy Swiss-Prot
Match: CB4B_SOLLC (Chlorophyll a-b binding protein CP24 10B, chloroplastic OS=Solanum lycopersicum GN=CAP10B PE=3 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 1.858e-84
Identity = 143/160 (89.38%), Postives = 156/160 (97.50%), Query Frame = 1
Query:    1 AFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAGQGKTP 480
            AFLKWYREAELIHGRWAMAAV+GIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAENFAN TGEQGYPGGKFFDPL LAGT+ +GVY+PDTEKL+RLK+AEIKH+RLAM+AMLIFYFEAGQGKTP
Sbjct:   91 AFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLERLKLAEIKHSRLAMLAMLIFYFEAGQGKTP 250          
BLAST of CX299942 vs. ExPASy Swiss-Prot
Match: CB4_SPIOL (Chlorophyll a-b binding protein CP24, chloroplastic OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 2.427e-84
Identity = 143/160 (89.38%), Postives = 156/160 (97.50%), Query Frame = 1
Query:    1 AFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAGQGKTP 480
            AFLKWYREAELIHGRWAM AV+GIFVGQAW+GIPWFEAGADPGA+APFSFG+LLGTQLLLMGWVESKRWVDFF+P+SQSVEWATPWSRTAENF+N+TGEQGYPGGKFFDPL LAGTI +GVY PDT+KL+RLK+AEIKHARLAM+AMLIFYFEAGQGKTP
Sbjct:   96 AFLKWYREAELIHGRWAMLAVLGIFVGQAWTGIPWFEAGADPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFDPDSQSVEWATPWSRTAENFSNSTGEQGYPGGKFFDPLSLAGTISNGVYNPDTDKLERLKLAEIKHARLAMLAMLIFYFEAGQGKTP 255          
BLAST of CX299942 vs. ExPASy Swiss-Prot
Match: CB4C_ARATH (Chlorophyll a-b binding protein CP29.3, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.3 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 8.794e-18
Identity = 64/164 (39.02%), Postives = 85/164 (51.83%), Query Frame = 1
Query:   16 YREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADP--------GAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAG-QGKTP 480
            +RE ELIHGRWAM   +G    +A +GI W +AG           G   PFS  +L+  ++L++G++E +R  +  +PE +                       YPGG +FDPL LA          D EKLD LK+AEIKH+RLAMVA LIF  +A   GK P
Sbjct:  137 FRECELIHGRWAMLGTLGAIAVEALTGIAWQDAGKVELVEGSSYLGQPLPFSLTTLIWIEVLVVGYIEFQRNSEL-DPEKRI----------------------YPGG-YFDPLGLAA---------DPEKLDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGP 267          
BLAST of CX299942 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.342e-17
Identity = 63/164 (38.41%), Postives = 85/164 (51.83%), Query Frame = 1
Query:   16 YREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAG--------ADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFE-AGQGKTP 480
            +RE ELIHGRWAM A +G    +  +G+ W +AG        +  G   PFS  +L+  ++L++G++E +R     N E  S                   ++ YPGGKFFDPL LA          D EK  +L++AEIKHARLAMVA L F  + A  GK P
Sbjct:  136 FRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQR-----NAELDS------------------EKRLYPGGKFFDPLGLAA---------DPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP 267          
BLAST of CX299942 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.829e-16
Identity = 62/167 (37.13%), Postives = 85/167 (50.90%), Query Frame = 1
Query:    7 LKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAG--------ADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFE-AGQGKTP 480
            L+ +RE ELIHGRWAM A +G    +  +G+ W +AG        +  G   PFS  +L+  ++L++G++E +R     N E  S                   ++ YPGGKFFDPL LA          D  K  +L++AEIKHARLAMV  L F  + A  GK P
Sbjct:  130 LQRFRECELIHGRWAMLATLGAITVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQR-----NAELDS------------------EKRLYPGGKFFDPLGLAS---------DPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGP 264          
BLAST of CX299942 vs. ExPASy Swiss-Prot
Match: CB29_CHLRE (Chlorophyll a-b binding protein CP29 OS=Chlamydomonas reinhardtii GN=Lhcb4 PE=1 SV=3)

HSP 1 Score: 80.8777 bits (198), Expect = 5.335e-15
Identity = 59/156 (37.82%), Postives = 76/156 (48.72%), Query Frame = 1
Query:   16 YREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAG-------ADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEA 462
            +RE ELIHGRWAM A +G  V +A +G+ W EAG       +  G   PFS   L+  +++L+G  E  R  +  NPE +                       YPGG  FDPL LA          D E+  RLK AEIKHARLAMV+   +  +A
Sbjct:  133 FRECELIHGRWAMLACLGALVAEATTGVSWVEAGKVELDGASYAGLSLPFSITQLIWIEVILVGGAEFYRNSE-TNPEKRC----------------------YPGG-VFDPLKLAS--------EDEERAFRLKTAEIKHARLAMVSFFGYGVQA 256          
BLAST of CX299942 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.648e-14
Identity = 50/157 (31.85%), Postives = 75/157 (47.77%), Query Frame = 1
Query:    7 LKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFE 459
            LKW  +AEL+H RWAM    GIF+ +  + I       W+ AG            +L   +L+L+GW E +RW D   P   + +   P ++          + GYPGG +FDPL        G       K+  L+  EIK+ RLAM+A++  +F+
Sbjct:  100 LKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFT---DTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT------DVGYPGGLWFDPL--------GWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQ 239          
BLAST of CX299942 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 5.898e-14
Identity = 49/157 (31.21%), Postives = 76/157 (48.41%), Query Frame = 1
Query:    7 LKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFE 459
            L+W ++AEL+H RWAM    GIF+ +  + I       W+ AG            +L   +L+L+GW E +RW D   P   + +   P ++          + GYPGG +FDPL        G       K+  L+  EIK+ RLAM+A++  +F+
Sbjct:  100 LRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFT---DTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT------DVGYPGGLWFDPL--------GWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQ 239          
BLAST of CX299942 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.230e-11
Identity = 52/165 (31.52%), Postives = 80/165 (48.48%), Query Frame = 1
Query:    7 LKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAG-QGKTP 480
            L+W+ +AEL++GRWAM  V G+ + + ++ I       W+ AG +       S  +L   + +L  +VE +RW D  NP S + +         + ++   GE GYPGG  F+PL  A T++              K  EI + RLAM+A L F  +    GK P
Sbjct:   88 LRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFA---SSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQD------PIFKQYSLPAGEVGYPGG-IFNPLNFAPTLE-------------AKEKEIANGRLAMLAFLGFIIQHNVTGKGP 229          
The following BLAST results are available for this feature:
BLAST of CX299942 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
CB4A_SOLLC4.423e-8691.25Chlorophyll a-b binding protein CP24 10A, chloropl... [more]
CB4B_SOLLC1.858e-8489.38Chlorophyll a-b binding protein CP24 10B, chloropl... [more]
CB4_SPIOL2.427e-8489.38Chlorophyll a-b binding protein CP24, chloroplasti... [more]
CB4C_ARATH8.794e-1839.02Chlorophyll a-b binding protein CP29.3, chloroplas... [more]
CB4A_ARATH3.342e-1738.41Chlorophyll a-b binding protein CP29.1, chloroplas... [more]
CB4B_ARATH2.829e-1637.13Chlorophyll a-b binding protein CP29.2, chloroplas... [more]
CB29_CHLRE5.335e-1537.82Chlorophyll a-b binding protein CP29 OS=Chlamydomo... [more]
CB12_PETHY2.648e-1431.85Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB12_SOLLC5.898e-1431.21Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB24_PEA1.230e-1131.52Chlorophyll a-b binding protein P4, chloroplastic ... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004C06SK SaltLeaf1 Citrus clementina cDNA clone C07004C06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299942 ID=CX299942|Name=CX299942|organism=Citrus clementina|type=EST|length=591bp
GCATTCCTGAAATGGTACAGAGAAGCAGAACTGATCCACGGACGATGGGC
AATGGCTGCAGTTGTTGGGATATTCGTCGGACAGGCGTGGAGTGGGATTC
CATGGTTCGAGGCTGGAGCAGATCCTGGAGCCATAGCACCCTTCTCCTTC
GGCTCACTCCTGGGAACCCAGCTTCTCCTTATGGGTTGGGTTGAGAGCAA
GCGGTGGGTTGATTTTTTCAATCCTGAATCTCAATCAGTTGAATGGGCAA
CACCTTGGTCAAGAACTGCTGAAAACTTTGCCAATGCGACTGGTGAACAA
GGCTACCCTGGTGGAAAGTTTTTTGATCCCTTATGTTTGGCTGGAACAAT
TAAGGATGGTGTCTACATTCCTGACACTGAGAAGCTTGACAGGCTCAAAG
TTGCTGAGATTAAACATGCTAGGCTTGCTATGGTGGCCATGTTGATTTTC
TACTTTGAAGCTGGCCAAGGCAAGACGCCACTTGGGGCTCTTGGTTTGTA
AAACATGCTTATGTAGATAACTCACTGATTGGTGTTAAAGCGTAATCAAT
CGGATGTATATGAGTTCCCTCAAAAAAAAAAAAAAAAAAAA
back to top