CX299945

Overview
NameCX299945
Unique NameCX299945
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length651
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX299945 vs. ExPASy Swiss-Prot
Match: RCA1_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Larrea tridentata GN=RCA1 PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.009e-68
Identity = 130/166 (78.31%), Postives = 141/166 (84.94%), Query Frame = 2
Query:    2 REDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFY-GKAAQQM-NVPVPEGCTDPTAENFDPTARSDDGSCQY 493
            REDRIGVCKGIFR DNVADDDIVKLVDTFPGQSIDFFGALRARVY DEVRKW          K LVNSKE  P+FEQP+MT++KLL YG M+VQEQENVKRVQLADKY+SEAALG+AN DAI+ G FY G+AAQQ+ NVPVPEGCTDP A N+DPTARSDDGSC Y
Sbjct:  309 REDRIGVCKGIFRTDNVADDDIVKLVDTFPGQSIDFFGALRARVYHDEVRKWVSEVGVDTIGKKLVNSKEGPPSFEQPKMTIDKLLGYGGMLVQEQENVKRVQLADKYMSEAALGDANNDAIKRGTFYGGQAAQQVGNVPVPEGCTDPQATNYDPTARSDDGSCVY 474          
BLAST of CX299945 vs. ExPASy Swiss-Prot
Match: RCA_ORYSJ (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Oryza sativa subsp. japonica GN=RCA PE=1 SV=2)

HSP 1 Score: 256.529 bits (654), Expect = 8.543e-68
Identity = 122/166 (73.49%), Postives = 143/166 (86.14%), Query Frame = 2
Query:    2 REDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFYGKAAQQM-NVPVPEGCTDPTAENFDPTARSDDGSCQYT 496
            R+DR+GVCKGIFR DNV D+DIVK+VD+FPGQSIDFFGALRARVYDDEVRKW          K LVNS+E  P FEQP+MT+EKL+EYG M+V+EQENVKRVQLA++YLSEAALG+AN DA+++G+FYG+ AQQ  N+PVPEGCTDP A+NFDPTARSDDGSC YT
Sbjct:  300 RDDRVGVCKGIFRTDNVPDEDIVKIVDSFPGQSIDFFGALRARVYDDEVRKWVSDTGVENIGKRLVNSREGPPEFEQPKMTIEKLMEYGYMLVKEQENVKRVQLAEQYLSEAALGDANSDAMKTGSFYGQGAQQAGNLPVPEGCTDPVAKNFDPTARSDDGSCLYT 465          
BLAST of CX299945 vs. ExPASy Swiss-Prot
Match: RCAA_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase A, chloroplastic OS=Hordeum vulgare GN=RCAA PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 7.232e-67
Identity = 118/165 (71.52%), Postives = 142/165 (86.06%), Query Frame = 2
Query:    2 REDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFYGKAAQQMNVPVPEGCTDPTAENFDPTARSDDGSCQYT 496
            R+DRIGVCKGIF+ DNV+D+ +VK+VDTFPGQSIDFFGALRARVYDDEVRKW          K LVNS++   TFEQP+MT+EKLLEYG+M+VQEQ+NVKRVQLAD Y+S+AALG+AN+DA+++G+FYGK AQQ  +PVPEGCTD  A+N+DPTARSDDGSC YT
Sbjct:  299 RDDRIGVCKGIFQTDNVSDESVVKIVDTFPGQSIDFFGALRARVYDDEVRKWVGSTGIENIGKRLVNSRDGPVTFEQPKMTVEKLLEYGHMLVQEQDNVKRVQLADTYMSQAALGDANQDAMKTGSFYGKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYT 463          
BLAST of CX299945 vs. ExPASy Swiss-Prot
Match: RCA_ARATH (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Arabidopsis thaliana GN=RCA PE=1 SV=2)

HSP 1 Score: 252.677 bits (644), Expect = 1.234e-66
Identity = 122/164 (74.39%), Postives = 134/164 (81.71%), Query Frame = 2
Query:    2 REDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFYGKAAQQMNVPVPEGCTDPTAENFDPTARSDDGSCQY 493
            REDRIGVCKGIFR D + D+DIV LVD FPGQSIDFFGALRARVYDDEVRK+          K LVNS+E  P FEQP MT EKL+EYGNM+V EQENVKRVQLA+ YLS+AALG+AN DAI  G FYGK AQQ+N+PVPEGCTDP AENFDPTARSDDG+C Y
Sbjct:  309 REDRIGVCKGIFRTDKIKDEDIVTLVDQFPGQSIDFFGALRARVYDDEVRKFVESLGVEKIGKRLVNSREGPPVFEQPEMTYEKLMEYGNMLVMEQENVKRVQLAETYLSQAALGDANADAIGRGTFYGKGAQQVNLPVPEGCTDPVAENFDPTARSDDGTCVY 472          
BLAST of CX299945 vs. ExPASy Swiss-Prot
Match: RCA_SPIOL (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 245.743 bits (626), Expect = 1.508e-64
Identity = 116/166 (69.88%), Postives = 135/166 (81.33%), Query Frame = 2
Query:    2 REDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFYGKAAQQMNVPVPEGCTDPTAENFDPTARSDDGSCQYTL 499
            REDRIGVC GIF+ D V  + +VKLVD FPGQSIDFFGALRARVY DEVRKW          K LVNSK+  P FEQP MT++KL+EYGNM+VQEQENVKRVQLAD+Y+S AALG+AN+DAI  G F+GKAAQQ+++PV +GCTDP A+N+DPTARSDDGSC Y L
Sbjct:  307 REDRIGVCTGIFKTDKVPAEHVVKLVDAFPGQSIDFFGALRARVYHDEVRKWVNSVGVDNVGKKLVNSKDGPPVFEQPEMTLQKLMEYGNMLVQEQENVKRVQLADQYMSSAALGDANKDAIDRGTFFGKAAQQVSLPVAQGCTDPEAKNYDPTARSDDGSCTYNL 472          
BLAST of CX299945 vs. ExPASy Swiss-Prot
Match: RCA_MALDO (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Malus domestica GN=RCA PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.564e-53
Identity = 103/129 (79.84%), Postives = 111/129 (86.05%), Query Frame = 2
Query:    2 REDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFYG 388
            REDRIGVC GIFR+DNVA +DIVKLVDTFPGQSIDFFGALRARVYDDEVRKW          K LVNSKE  PTFEQP+MT+EKLLEYGNM+VQEQENVKRVQLADKYLSEAALG+AN DA+ +G FYG
Sbjct:  309 REDRIGVCIGIFRSDNVAKEDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWITGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLVQEQENVKRVQLADKYLSEAALGDANSDAMNTGTFYG 437          
BLAST of CX299945 vs. ExPASy Swiss-Prot
Match: RCAB_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase B, chloroplastic OS=Hordeum vulgare GN=RCAB PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 2.950e-52
Identity = 98/130 (75.38%), Postives = 113/130 (86.92%), Query Frame = 2
Query:    2 REDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFYGK 391
            REDRIGVCKGIFR DNV D+ +V+LVDTFPGQSIDFFGALRARVYDDEVRKW          K LVNS+E  PTF+QP+MT+EKL+EYG+M+VQEQENVKRVQLADKYLSEAALG+AN+DA+++G FYGK
Sbjct:  296 REDRIGVCKGIFRTDNVPDEAVVRLVDTFPGQSIDFFGALRARVYDDEVRKWVGEIGVENISKRLVNSREGPPTFDQPKMTIEKLMEYGHMLVQEQENVKRVQLADKYLSEAALGQANDDAMKTGAFYGK 425          
BLAST of CX299945 vs. ExPASy Swiss-Prot
Match: RCA_PHAAU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus aureus GN=RCA PE=2 SV=2)

HSP 1 Score: 200.29 bits (508), Expect = 7.266e-51
Identity = 95/128 (74.22%), Postives = 110/128 (85.94%), Query Frame = 2
Query:    2 REDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFY 385
            R+DR+GVCKGIFR D V ++DI KLVDTFPGQSIDFFGALRARVYDDEVRKW          K LVNSKE  PTF+QP+M+++KLL+YGNM+VQEQENVKRVQLADKYL+EAALG ANEDAI+SG+F+
Sbjct:  311 RDDRVGVCKGIFRTDGVPEEDITKLVDTFPGQSIDFFGALRARVYDDEVRKWISGVGVDATGKKLVNSKEGPPTFDQPKMSLDKLLQYGNMLVQEQENVKRVQLADKYLNEAALGNANEDAIKSGSFF 438          
BLAST of CX299945 vs. ExPASy Swiss-Prot
Match: RCA2_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Larrea tridentata GN=RCA2 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 9.490e-51
Identity = 96/127 (75.59%), Postives = 109/127 (85.83%), Query Frame = 2
Query:    2 REDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNF 382
            REDRIGVCKGIFR DNV ++DIVK+VD FPGQSIDFFGALRARVYDDEVRKW          K LVNSKE  PTFEQP+MT++KLL+YGNM+V+EQENVKRVQLADKY+SEAALG+AN+DAI+ G F
Sbjct:  309 REDRIGVCKGIFRTDNVPEEDIVKVVDQFPGQSIDFFGALRARVYDDEVRKWVSEVGVDTIGKKLVNSKEGPPTFEQPKMTIDKLLQYGNMLVEEQENVKRVQLADKYMSEAALGDANQDAIKRGTF 435          
BLAST of CX299945 vs. ExPASy Swiss-Prot
Match: RCA_MAIZE (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Zea mays GN=RCA1 PE=2 SV=3)

HSP 1 Score: 194.512 bits (493), Expect = 3.987e-49
Identity = 93/128 (72.66%), Postives = 110/128 (85.94%), Query Frame = 2
Query:    2 REDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFY 385
            REDRIGVCKGIFR D V ++ +V+LVDTFPGQSIDFFGALRARVYDDEVR+W          + LVNSKE  PTFEQP++T+EKLLEYG+M+V EQENVKRVQLADKYL+EAALGEANEDA+++G+F+
Sbjct:  305 REDRIGVCKGIFRTDGVDEEHVVQLVDTFPGQSIDFFGALRARVYDDEVRRWVSETGVENIARKLVNSKEGPPTFEQPKITIEKLLEYGHMLVAEQENVKRVQLADKYLNEAALGEANEDAMKTGSFF 432          
The following BLAST results are available for this feature:
BLAST of CX299945 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
RCA1_LARTR1.009e-6878.31Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ORYSJ8.543e-6873.49Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAA_HORVU7.232e-6771.52Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ARATH1.234e-6674.39Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_SPIOL1.508e-6469.88Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_MALDO1.564e-5379.84Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAB_HORVU2.950e-5275.38Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAAU7.266e-5174.22Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_LARTR9.490e-5175.59Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_MAIZE3.987e-4972.66Ribulose bisphosphate carboxylase/oxygenase activa... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004C09SK SaltLeaf1 Citrus clementina cDNA clone C07004C09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299945 ID=CX299945|Name=CX299945|organism=Citrus clementina|type=EST|length=651bp
AAGGGAGGACCGTATTGGTGTGTGCAAGGGTATCTTCAGGAATGACAATG
TGGCTGATGACGACATTGTCAAGCTTGTCGACACCTTCCCCGGCCAATCC
ATTGATTTCTTTGGAGCCCTGAGGGCCAGAGTCTATGATGATGAGGTGAG
GAAGTGGATCTCTGGTGTTGGTGTTGGAAGCATTGGCAAGAGCCTTGTGA
ACTCAAAGGAAGCAGCCCCAACATTCGAGCAACCAAGGATGACAATGGAG
AAGCTGCTCGAGTACGGAAACATGATTGTGCAAGAGCAAGAGAATGTGAA
GAGAGTTCAGTTGGCTGACAAGTATTTGAGTGAGGCCGCTCTTGGTGAAG
CTAATGAAGATGCTATTCAGAGTGGAAATTTCTATGGCAAAGCAGCCCAG
CAAATGAATGTTCCAGTTCCTGAAGGATGTACTGATCCTACTGCAGAAAA
CTTTGATCCAACTGCAAGAAGTGATGATGGAAGCTGCCAATACACGCTTT
AGGCCTTGTTTGTAAGGGTTGAGAAGTGTCGCACTTTGCTTAGGATGTGA
GATATTCAAATAATATTGTTGCATTTTCATTTCTTTGTTAATTAGAAAGA
ATCCTCTAATTTTGTGTTATATCACAACTCTTTATTCGATCTTTAAAAGG
T
back to top