CX299946

Overview
NameCX299946
Unique NameCX299946
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length639
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9586 contig Ccv1_Contig9586:128..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX299946 vs. ExPASy Swiss-Prot
Match: RL363_ARATH (60S ribosomal protein L36-3 OS=Arabidopsis thaliana GN=RPL36C PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.038e-42
Identity = 87/105 (82.86%), Postives = 97/105 (92.38%), Query Frame = 3
Query:   84 TGLFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVKNLIREVAGFAPYERRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKMRS--AGGAEKKK 392
            TGLFVGLNKGHVVTK+E PPRP++RKGKTSKR  F++NLI+EVAG APYE+RITELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS+ LRKMRS  AG +EKKK
Sbjct:    4 TGLFVGLNKGHVVTKREQPPRPNNRKGKTSKRTIFIRNLIKEVAGQAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGAGASEKKK 108          
BLAST of CX299946 vs. ExPASy Swiss-Prot
Match: RL362_ARATH (60S ribosomal protein L36-2 OS=Arabidopsis thaliana GN=RPL36B PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.661e-42
Identity = 88/112 (78.57%), Postives = 96/112 (85.71%), Query Frame = 3
Query:   63 MAPKQPNTGLFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVKNLIREVAGFAPYERRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKMRSAGG--AEKKK 392
            M   Q  TGLFVGLNKGHVVT++EL PRP  RKGKTSKR  F++NLI+EVAG APYE+RITELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS+ LRKMRS GG   EKKK
Sbjct:    1 MTTPQVKTGLFVGLNKGHVVTRRELAPRPRSRKGKTSKRTIFIRNLIKEVAGQAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGGATEKKK 112          
BLAST of CX299946 vs. ExPASy Swiss-Prot
Match: RL361_ARATH (60S ribosomal protein L36-1 OS=Arabidopsis thaliana GN=RPL36A PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.725e-41
Identity = 86/105 (81.90%), Postives = 94/105 (89.52%), Query Frame = 3
Query:   84 TGLFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVKNLIREVAGFAPYERRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKMRSAGG---AEKK 389
            TGLFVGLNKGHVVT++EL PRP+ RKGKTSKR  F++ LIREVAG APYE+RITELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS+ LRKMRS GG   AEKK
Sbjct:    8 TGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTIFIRKLIREVAGMAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSLGGAAAAEKK 112          
BLAST of CX299946 vs. ExPASy Swiss-Prot
Match: RL36_DAUCA (60S ribosomal protein L36 OS=Daucus carota GN=RPL36 PE=3 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 3.722e-36
Identity = 74/91 (81.32%), Postives = 81/91 (89.01%), Query Frame = 3
Query:   63 MAPKQPNTGLFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVKNLIREVAGFAPYERRITELLKVGKDKRALKVAKRKLGTHKRAKKKRE 335
            MAPKQPNTGLFVGLNKGH+VTKKEL PRPSDRKGKTSKR HFV+NLIREVAGF PYE+RITELLKVGKDKRALKV + K+G H +  K+ E
Sbjct:    1 MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKTSKRTHFVRNLIREVAGFXPYEKRITELLKVGKDKRALKVRQEKVG-HSQESKEEE 90          
BLAST of CX299946 vs. ExPASy Swiss-Prot
Match: RL36_ENTCP (60S ribosomal protein L36 OS=Enteromorpha compressa GN=RL36 PE=3 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.052e-30
Identity = 67/96 (69.79%), Postives = 77/96 (80.21%), Query Frame = 3
Query:   96 VGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVKNLIREVAGFAPYERRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKMRSAGGAE 383
            VGLNKGH VTKK   PRPS RKG  S+RV  V+ ++REVAG+APYERR+ ELLKVGKDKRALK+ KRKLGTH R KKKREEM+  LRKM++A   E
Sbjct:    6 VGLNKGHQVTKKAGTPRPSRRKGFLSQRVKKVRAVVREVAGWAPYERRVMELLKVGKDKRALKMCKRKLGTHMRGKKKREEMAGVLRKMQAASKGE 101          
BLAST of CX299946 vs. ExPASy Swiss-Prot
Match: RL36_IXOSC (60S ribosomal protein L36 OS=Ixodes scapularis GN=RpL36 PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.418e-27
Identity = 62/100 (62.00%), Postives = 72/100 (72.00%), Query Frame = 3
Query:   90 LFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVKNLIREVAGFAPYERRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKMRSAGGAEKK 389
            L VGL KGH VTK E  PRPS RKG  SK   FV++LIREV GFAP+ERR  ELLKV KDKRALK  K++LGTH R K+KR+E+SN L   R A   ++K
Sbjct:    7 LAVGLGKGHKVTKNEYKPRPSRRKGALSKHTRFVRDLIREVCGFAPFERRAMELLKVSKDKRALKFIKKRLGTHLRGKRKRDELSNVLVAQRKAAAHKEK 106          
BLAST of CX299946 vs. ExPASy Swiss-Prot
Match: RL36_PONAB (60S ribosomal protein L36 OS=Pongo abelii GN=RPL36 PE=3 SV=3)

HSP 1 Score: 119.013 bits (297), Expect = 2.047e-26
Identity = 59/92 (64.13%), Postives = 70/92 (76.09%), Query Frame = 3
Query:   96 VGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVKNLIREVAGFAPYERRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKMRSA 371
            VGLNKGH VTK    PR S R+G+ +K   FV+++IREV GFAPYERR  ELLKV KDKRALK  K+++GTH RAK+KREE+SN L  MR A
Sbjct:    9 VGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRKA 100          
BLAST of CX299946 vs. ExPASy Swiss-Prot
Match: RL36_HUMAN (60S ribosomal protein L36 OS=Homo sapiens GN=RPL36 PE=1 SV=3)

HSP 1 Score: 119.013 bits (297), Expect = 2.047e-26
Identity = 59/92 (64.13%), Postives = 70/92 (76.09%), Query Frame = 3
Query:   96 VGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVKNLIREVAGFAPYERRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKMRSA 371
            VGLNKGH VTK    PR S R+G+ +K   FV+++IREV GFAPYERR  ELLKV KDKRALK  K+++GTH RAK+KREE+SN L  MR A
Sbjct:    9 VGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRKA 100          
BLAST of CX299946 vs. ExPASy Swiss-Prot
Match: RL36A_SCHPO (60S ribosomal protein L36-A OS=Schizosaccharomyces pombe GN=rpl36a PE=2 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 2.673e-26
Identity = 57/95 (60.00%), Postives = 77/95 (81.05%), Query Frame = 3
Query:   87 GLFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVKNLIREVAGFAPYERRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKMRSA 371
            GL VGLNKG V+TK++LP RPS RKG+ SKR  FV++++REVAGFAPYERR+ EL++  +DKRA K+AK++LGT KRAK K EE+++ ++  R A
Sbjct:    4 GLVVGLNKGKVLTKRQLPERPSRRKGQLSKRTSFVRSIVREVAGFAPYERRVMELIRNSQDKRARKLAKKRLGTLKRAKGKIEELTSVIQSSRLA 98          
BLAST of CX299946 vs. ExPASy Swiss-Prot
Match: RL36_BOVIN (60S ribosomal protein L36 OS=Bos taurus GN=RPL36 PE=3 SV=3)

HSP 1 Score: 118.242 bits (295), Expect = 3.492e-26
Identity = 59/92 (64.13%), Postives = 70/92 (76.09%), Query Frame = 3
Query:   96 VGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVKNLIREVAGFAPYERRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKMRSA 371
            VGLNKGH VTK    PR S R+G+ +K   FV+++IREV GFAPYERR  ELLKV KDKRALK  K+++GTH RAK+KREE+SN L  MR A
Sbjct:    9 VGLNKGHKVTKNVGKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRKA 100          
The following BLAST results are available for this feature:
BLAST of CX299946 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
RL363_ARATH2.038e-4282.8660S ribosomal protein L36-3 OS=Arabidopsis thalian... [more]
RL362_ARATH2.661e-4278.5760S ribosomal protein L36-2 OS=Arabidopsis thalian... [more]
RL361_ARATH1.725e-4181.9060S ribosomal protein L36-1 OS=Arabidopsis thalian... [more]
RL36_DAUCA3.722e-3681.3260S ribosomal protein L36 OS=Daucus carota GN=RPL3... [more]
RL36_ENTCP3.052e-3069.7960S ribosomal protein L36 OS=Enteromorpha compress... [more]
RL36_IXOSC1.418e-2762.0060S ribosomal protein L36 OS=Ixodes scapularis GN=... [more]
RL36_PONAB2.047e-2664.1360S ribosomal protein L36 OS=Pongo abelii GN=RPL36... [more]
RL36_HUMAN2.047e-2664.1360S ribosomal protein L36 OS=Homo sapiens GN=RPL36... [more]
RL36A_SCHPO2.673e-2660.0060S ribosomal protein L36-A OS=Schizosaccharomyces... [more]
RL36_BOVIN3.492e-2664.1360S ribosomal protein L36 OS=Bos taurus GN=RPL36 P... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004C10SK SaltLeaf1 Citrus clementina cDNA clone C07004C10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299946 ID=CX299946|Name=CX299946|organism=Citrus clementina|type=EST|length=639bp
GGGTCTTTCTGAAGAATTTTCTGTACTCTGATGTGTATTGTGGGTGTTGG
TAATTACAGGTGATGGCTCCAAAGCAGCCAAATACTGGCCTTTTTGTGGG
TCTAAACAAAGGACATGTCGTGACCAAGAAGGAGTTGCCTCCCCGCCCTT
CTGATAGAAAAGGCAAAACTAGTAAGAGAGTCCATTTTGTGAAGAACCTC
ATTAGGGAGGTTGCTGGTTTTGCTCCCTATGAAAGGAGGATTACTGAACT
TCTTAAAGTTGGGAAAGATAAGCGTGCTTTGAAGGTGGCAAAGAGAAAGT
TGGGCACTCACAAGAGAGCCAAGAAGAAGCGCGAGGAAATGTCCAATGCT
CTACGCAAGATGAGGTCGGCTGGAGGTGCAGAGAAGAAGAAGTGAAGCCT
CATTCAAGGTTTCTTTTAGATTCATCAGTGAAAGAATTTTATTTAGCTTT
TGTTCTTCTAATATTGGAATTTTGGTTAGAGTTTTAGACTTGCTTTGAAA
TGTTAACTGTACTTTGTTTCCAATGAGAGAGTTCAGTTTTGTTTCCTTTG
TCTGTGAAATTTGAGTATCTTGTTACTCACAGTTGCCAGTTTTTTAATCA
TCGATAAGAATTGATTATCCAAAAAAAAAAAAAAAAAAA
back to top