CX299947

Overview
NameCX299947
Unique NameCX299947
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length491
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig56 contig Ccv1_Contig56:65..555. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX299947 vs. ExPASy Swiss-Prot
Match: PST2_ARATH (Photosystem II 5 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=PSBT PE=2 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 4.669e-12
Identity = 42/96 (43.75%), Postives = 56/96 (58.33%), Query Frame = 2
Query:   56 SMAKNPAATRAKRGGLIVVAKAASSKAENVSMEFKNKDESSSNGRRELVFXXXXXXXXXXXXXXXXESEEPKRGTPDAKKKYAPVCVTMPTARICR 343
            ++AK P+AT  +R  L VV  + S    ++ +    K++SS+  RR+L+F                E EEPKRGT  AKKKYA VCVTMPTA+ICR
Sbjct:   13 AVAKVPSATGGRR--LSVVRASTSDNTPSLEV----KEQSSTTMRRDLMFTAAAAAVCSLAKVAMAEEEEPKRGTEAAKKKYAQVCVTMPTAKICR 102          
BLAST of CX299947 vs. ExPASy Swiss-Prot
Match: PST2_GOSHI (Photosystem II 5 kDa protein, chloroplastic OS=Gossypium hirsutum GN=PSBT PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 6.742e-11
Identity = 41/100 (41.00%), Postives = 55/100 (55.00%), Query Frame = 2
Query:   44 LLPTSMAKNPAATRAKRGGLIVVAKAASSKAENVSMEFKNKDESSSNGRRELVFXXXXXXXXXXXXXXXXESEEPKRGTPDAKKKYAPVCVTMPTARICR 343
            L  T++ K       +R  L+V   A  ++ E+V M  + K E + NGRRE++F                 + EPKRG+ +AKK YAPVCVTMPTARICR
Sbjct:   11 LSTTNLTKGSPRITQRR--LVVANAAKGAQVESVQMSGERKTEGN-NGRREMMFAAAAAAICSVAGVA---TAEPKRGSAEAKKAYAPVCVTMPTARICR 104          
The following BLAST results are available for this feature:
BLAST of CX299947 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PST2_ARATH4.669e-1243.75Photosystem II 5 kDa protein, chloroplastic OS=Ara... [more]
PST2_GOSHI6.742e-1141.00Photosystem II 5 kDa protein, chloroplastic OS=Gos... [more]
back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004C11SK SaltLeaf1 Citrus clementina cDNA clone C07004C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299947 ID=CX299947|Name=CX299947|organism=Citrus clementina|type=EST|length=491bp
GTCAGCAGCAAACATGGCTTCGATGACCATGGCAGCAGCCTCATTACTGC
CCACAAGCATGGCCAAAAACCCAGCAGCAACAAGAGCGAAGAGAGGAGGC
CTCATCGTTGTGGCCAAGGCTGCATCATCAAAAGCTGAAAATGTGAGCAT
GGAATTCAAGAACAAGGATGAGAGCAGCAGCAACGGAAGAAGGGAGCTTG
TGTTTGCAGCAGCAGCTGCAGCAGCTTGCTCCATTGCAAAAGTTGCAATG
GCTGAATCTGAGGAGCCCAAACGAGGGACCCCAGATGCTAAGAAGAAGTA
TGCTCCTGTTTGTGTCACAATGCCTACTGCTAGAATCTGTCGCAAGTGAG
AATGTTTTTTAATTTTCATGCTGTTGATGTTAATTAGTGTCCAATTAATT
GATATGAGATCAATGTTAAAAGCTGTGAGCATCTGTATCTTGTAATTGGA
GAATCCTGTTTATTTTATCTTGTCAAAAAAAAAAAAAAAAA
back to top